akishin@hep.sinp.msu.ru The arcing causes degradation of solar array at malfunction of instruments on satellites. The discharge is caused by differential potential between satellite body and insulator surfaces like coverglass of solar arrays, whitch are charged by ambient plasma. ... 0.01 ­ 1 [1-3]. U=100 . ... p =1 , 400. ... 2004 . ... Development of 400V. Solar Array Technology for Low Earth Orbit Plasma Environment. ... Stretched Lens Array (SLA), A Reliable Solar Array for Any Orbit. ...

Еще в разделе: (Показать все результаты (>128) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Pravdin.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

On problem of interpretation and forecasting space-temporary variations of geophysical fields on results of deep scientific drilling Esipko O.A., Kolbasova A.V., Rosaev A.E. In the process of boring the deep bore holes, as scientific, so and industrial one's living, and when processing the received results, the problem of large arrays of data analyses appears. ... The example of geophysical data development As an example of with depth and variation log data with 0.2 meters of (verified) data. ...

Еще в разделе: (Показать все результаты (>52) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/poster-sessions.html
• http://acat02.sinp.msu.ru/presentations/matousek/ACAT2002_Matousek.pdf

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>38) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• S. Piskarev. Shadowing in approximations of abstract parabolic equations //

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>64) - sai.msu.ru/ )

ASA) (ASA) 20 c . ... 800 , ASA . ... Acoustic tomography with nonuniformly sparsed ring antenna array The main goal is to study: the quality of ultrasound fields generated by therapeutic multi-element arrays when the focus is steered electronically; nonlinear propagation effects in heating of soft tissue in the presence of ribs using therapeutic arrays. ...

Еще в разделе: (Показать все результаты (>40) - acoustics.phys.msu.ru/ )

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>347) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Determination analysis as a method for diagnostics of ecosystem condition

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

Faculty of Physics, Lomonosov Moscow State University Advanced Quantum Field Theory: Modern Applications in HEP, Astro & Cond-Mat Instructor: assist. prof., Dr. Oleg Kharlanov Term 2 Examination Syllabus (Fall 2014) 1. ... Self-consistent field approximation: the Hartree­Fock and Hartree­Fock­Roothaan equations; a qualitative analysis of the approximations used. ... Fundamentals of the Density functional theory: the energy functional, the Hohenberg­Kohn theorems, the universal functional F[n(x)] . ...

Еще в разделе: (Показать все результаты (>6) - theorphys.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Recently we described a novel method for forming substrate-supported macroscopically-aligned lipid bilayers by self-assembling phospholipids into nanotubular structures inside ordered nanochannels of anodic aluminum oxide (AAO) [1]. We have also shown that these nanotubular bilayers retain many properties of unsupported bilayers and are suitable for incorporating transmembrane peptides and small membrane proteins [2]. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>22) - www.msm.biophys.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>3957) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SDP home page

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1232) - swx.sinp.msu.ru/ )

Diploma thesis abstract Combined optoacoustic and laser ultrasonic tomography of biological tissues Bychkov A.S. Academic adviser: Prof. Dr. Karabutov A.A. This diploma thesis contains 61 pages, 28 illustrations, 1 table, 37 references, 2 appendices. ... Mathematical modelling of sensitivity maps of phased arrays with various geometries was conducted. ... Experiments on modelling of needle insertion into blood vessel model and comparison of calculated and experimental data were conducted. ...

Еще в разделе: (Показать все результаты (>26) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Simonova_Karabutov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Lipatov_Magnitskiy_en.pdf

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>264) - www.philol.msu.ru/ )

• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>17) - www.bukivedi.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>11) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

... Consider the problem of exchanging one dollar into cents, which could be formulated in the following way: How many are the different solutions of the Diophantine equation 100 = x1 + 2 x2 + 5 x3 + 10 x4 + 20 x5 + 50 x6 , where x1, ..., x6 are unknowns, taking non negative integer values? ... A corresponding programming language which is appropriate of using by secondary students should answer to several criteria. ... One could apply the programming language PHP to solve the above mentioned problem. ...

Еще в разделе: (Показать все результаты (>313) - chem.msu.ru/ )

• Exciplexes on INTERNET
• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)
• Moscow University Chemistry Bulletin Vol. 50, No. 4, P. 238 (2009)

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>4) - www.sciencepark.ru/ )

• MSU Science Park - About us

... Технология устройств CPLD (complex programmable logic device) - технология программируемых логических устройств со сложностью, занимающей диапазон примерно между PAL (Programmable Array Logic) и FPGA (Field-programmable gate array), и с сочетанием их архитектурных особенностей. ... Общие особенности технологии CPLD с PAL: . ... PAL обычно имеют по несколько сотен логических устройств (в лучшем случае), в то время как в FPGA могут располагать ими в количествах от десятков тысяч до нескольких...

Еще в разделе: (Показать все результаты (>15) - fpga.parallel.ru/ )

• Терминология
• Конференции по реконфигурируемым системам
• Строение и история развития микросхем с реконфигурируемой архитектурой