... Online Services | ... Construct your query and output by sequental openings of needed fields. One output field must be selected (not be blank) at least. ... Query parameters: . Select for output . ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ... Excited energy(keV) . ...

Еще в разделе: (Показать все результаты (>35) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nuclear Reaction Threshold and Energy Values
• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => NSR Search Engine

... borse chanel , ?I have coached dozens of young girls that can now sing almost exactly like celine Dion. ... Guidelines on options are not distinctive, there are some which have exactly precisely number. Given that early 1990?s this particular code been recently designated by Two Letters then 4 numbers. ...

Еще в разделе: (Показать все результаты (>149) - elana.sinp.msu.ru/ )

• ?SoBe Supercar Rents Number One Top Big Shot Luxury Lifestyle Invest.? He asked
• Наши ветераны | С Днем Победы!
• The busy new mom hosts a lot of different of programs for I | С Днем Победы!

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>213) - www.genebee.msu.ru/ )

• GeneBee Motifs' Map - Advanced
• GeneBee BLAST 2.2.8 Services
• Multiple alignment

About BAFIZ . ... BAFIZ is a program devoted to the development of a distributed network of the knowledge and data bases for research of fundamental properties of the matter and applied nuclear physics. The project sponsored by Russian Foundation of Basic Research , RFBR reference number is 95-07-19502. ... This Page is developed at Laboratory of Computational Mathematics, . ... Last updated on 2 September 1999 . Copyright 1999 Laboratory of Computational Mathematics (DRCM) ...

Еще в разделе: (Показать все результаты (>13) - dbserv.sinp.msu.ru/ )

• Catalogue of Space Storms

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... Journals . ... All partners . ... The Faculty of Journalism, Lomonosov Moscow State University publishes a number of academic journals, primarily in the Russian language. ... The academic journal World of Media.љ Journalљof Russian Media and Journalism Studies is published by the non-commercial partnership National Association of Mass Media Researchers in cooperation with the Faculty of Journalism. ...

Еще в разделе: (Показать все результаты (>169) - www.journ.msu.ru/ )

• Fast Facts about the Faculty of Journalism :: Department of Journalism, M. V.
• Periodical Press :: Department of Journalism, M. V. Lomonosov Moscow State

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>147) - www.msu.ru/ )

• Scientific and scholarly publications in 2009
• FACULTY OF COMPUTATIONAL MATHEMATICS AND CYBERNETICS
• Conference Participation 2003

Comparative and Adjectival Phrases: What is Richer, Heavier and More Sound Problem: Russian and English both have morphological and analytical comparatives (MC and AC respectively), (1). ... Attributive ACs are ok in both languages, (4). ... Structures: We suppose that a comparative can belong to one of the two types of constituents: MCs are instances of some Deg(ree) Phrases headed by the degree affix, whereas ACs are ordinary APs with the degree marker (more) in Spec, AP. ...

Еще в разделе: (Показать все результаты (>322) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/trugman.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/ramaglia.pdf
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Speaking_writing_Navajo@CAIL_1996.pdf

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf
• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/seminar/Yakovenko.pdf

... Annex (e.g. 3.1) (3) Paragraph/ Figure/Table/ Note (e.g. Table 1) 4 Type of comment2 5 Comment (justification for change) by the MB Date: (6) Document: (7) Secretariat observations on each comment submitted Proposed change by the MB RU RU RU RU 2 2 2 2 Row 2 Row 4 Row 4 Row 5 ed ed ed te SEPs are not fluxes , but particles It is desirable to add that Wolf number is also known as the sunspot number. ... CLOSED: Accepted and implemented in modified form CLOSED: Accepted and RU 2 Row 16 . ...

Еще в разделе: (Показать все результаты (>8) - srd.sinp.msu.ru/ )

... Please be careful while filling the information. All fields labeled with * must be filled. Be careful writing the second name and e-mail address. The procedure of login/password recovery will be impossible without exact spelling of these fields. If you can be available as a reviewer, please turn on the button in the appropriate section. First name . Second name . ... E-mail address . ... Available as a reviewer? ... Enter preffered user name . ...

Еще в разделе: (Показать все результаты (>1288) - zmmu.msu.ru/ )

• Tropical centre
• Ornithology
• Monitoring of common birds

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>9) - npidb.belozersky.msu.ru/ )

• NPIDB: Interaction classes
• NPIDB: Families of interaction class

... Reynolds Number on the line l=100mm: 2,2*1000000 to 1,5*10000000 . ... Supersonic aerodynamic unit A-11 is a short time aerodynamic tube of ballon ejector type without a heater. ... The unit is provided with IAB-451, a high-speed video camera, an infrared window ZnSe, a thermal image camera, an ADC National Instruments, pressure sensors IKD, software was designed in the application package Labiew 7.0, Intel Pentium IV computer. ... A supersonic nozzle with the installed model in the working part. ...

Еще в разделе: (Показать все результаты (>4) - termogaz.imec.msu.ru/ )

• AR-2 main_e
• AR-3main_e

... about ERC . education . research . ... The Lomonosov Moscow State University (MSU) has been training specialists in nanotechnology, nanomaterials and nanosystems for nearly ten years . ... MSU Nanotechnology Education and Research Center (ERC) was established to consolidate efforts of MSU units aimed at research and development and true cross-disciplinary education in nanotechnology, nanomaterials and nanosystems. ... Fundamentals of Nanotechnology? was the first step in ERC?s activity. ...

Еще в разделе: (Показать все результаты (>33) - nano.msu.ru/ )

• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and

Studying at MU Programs and degrees . ... Moscow State University provides a wide range educational services and educational programmes. ... International students are offered Bachelour (4 years full time) and Master programmes (2 years full time). A number of our faculties train both domestic and international students according to Bachelour and Master programmes with granting Bachelour and Master diplomas. ... Please, contact International Students Office for information on the topics offered. ...

Еще в разделе: (Показать все результаты (>9) - www.ied.msu.ru/ )

... E-mail: Tchytannya@gmail.com Website of the Conference: www.tchytannya.org.ua Mailing address: National University "Law Academy of Ukraine named after Yaroslav Mudriy", Department of the Constitutional Law of Ukraine, organizing committee of The International Science Conference of Young Scientists, Researchers, Postgraduates and Students "Values of modern constitutionalism (V Todyka's readings)" Pushkinska street, 77, Kharkiv, 61024, Ukraine. ...

Еще в разделе: (Показать все результаты (>3) - www.law.msu.ru/ )

... Nonlinear Properties of Damaged Objects: Application to Crack Detection . ... Nonlinear properties have been experimentally evaluated for a number of thick glass plates being damaged by a thermal shock. ... More damage leads to higher nonlinearity. Nonlinearity of strongly damaged plates increased by the factor 300 compared to the intact ones. High nonlinearity in cracked samples has been confirmed by a strong manifestation of frequency-up and frequency-down conversion phenomena. ...

Еще в разделе: (Показать все результаты (>173) - acs366.phys.msu.su/ )

• ISNA-16
• Hotel reservation

Program H2O-H2S-NaCl User manual About the software 1 Program installation 1 Files and folders 1 Creating data files 2 User interface of the H2O-H2S-NaCl program 2 Initial data 2 Computation results 3 Working with H2O-H2S-NaCl program 3 Additional Comments 4 References 4 Appendix. ... Working with H2O-H2S-NaCl program Program's interface implies switching between the program window with its control items and the Excel workbook with the initial data and the computation results. ... the xls data file | ...

Еще в разделе: (Показать все результаты (>73) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsExt.doc
• Faculty of Geology >> Information for foreign students
• Faculty of Geology >> Departments

... Another strong point of this model is that the participants can reach not only intellectual understanding but also an affective tolerance of cultural differences in the process of intercultural communication (Bennett, 1986). This training model also has its limitations. ... Many scholars and trainers argue that applying a single model of intercultural training may not sufficiently prepare participants to function properly and effectively in a new cultural environment (Chen & Starosta, 1998 : 267). ...

Еще в разделе: (Показать все результаты (>194) - www.prof.msu.ru/ )

• VI Fulbright Summer School in the Humanities
• PROFESSIONALS FOR COOPERATION ASSOCIATION
• Region Department of Moscow oblast'

Moscow Times о российских программах Executive MBA . Moscow Times цитирует директора программы Executive MBA ВШБ МГУ Вячеслава Болтрукевича и студента группы ЕМВА11.н Алексея Богатырева в статье Biz School for Executives Entices Students . ... In his estimation, the education that he's receiving in the EMBA program at Moscow State University's Graduate School of Business is about equal to that of Western schools. ... He said he's now ready to lead any project in any sphere of business. ...

Еще в разделе: (Показать все результаты (>1449) - www.mgubs.ru/ )

• Высшая школа бизнеса МГУ им. Ломоносова