... Asn Pro Ser Ser Leu .. ... CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN 1 MVGSSEAGGEAWRGRYYRLEEVQKHNNSQSTWIIVHHRIYDITKFLDEHP .: ... HUMAN , MOUSE } vs { CAEEL , PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL } vs { PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI } vs { MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI , MARPO } vs { BRANA , VICFA } HUMAN + + + + MOUSE + + + + CAEEL + + + VICFA - BRANA - MARPO + ...

Еще в разделе: (Показать все результаты (>4501) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/FBB/year_08/term4/trees.pdf

Slippage on hierarchical superhydrophobic surfaces (theory, simulation) The exceptional wetting properties of superhydrophobic (SH) surfaces [1] have motivated numerous applications in microfluidics. ... Recent experiments have shown that a hierarchical surface with nanoposts lying on the top of microposts does not necessarily lead to an increase in the effective slip length [5]. ... The main goal is to determine, how the effective slip length depends on the number of hierarchy levels. ...

Еще в разделе: (Показать все результаты (>28) - nanofluidics.phys.msu.ru/ )

• Contacts

... New approaches to the studies of associating ionic polysaccharides in solution and at interface . Co-ordinator - Professor M.Rinaudo . The main objective of the project is to understand the structure and nature of aggregates formed in aqueous solutions of industrially important ionic polysaccharides: chitosan and hydrophobically modified (HM) chitosan. ... Five research teams (two from INTAS members and three from Russia) with complementary expertise will be involved in the project. ...

Еще в разделе: (Показать все результаты (>260) - polly.phys.msu.ru/ )

Site navigation: . ... Publications . ... SPDC Laboratory . ... This website uses Javascript for many elements such as the menus and page customization. ... Using a clever design of polarization optic, Italian researchers have successfully created four-level 'ququart' quantum states using the polarization and orbital angular momentum of single photons. ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>45) - qi.phys.msu.ru/ )

... The 2008 has continued the process of setting up the innovative nature of higher education and its dynamic development. ... Nowadays, country's Higher School faces several questions - what is the essence of new schools: secondary, Higher, additional and professional ones; what are society's future requirements; how retain Higher School traditions during country's innovative development; what forms of education could ensure professional training of youth? ... Happy New Year! ...

Еще в разделе: (Показать все результаты (>134) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/2011_10_31/3.pdf
• http://www.rsr-online.ru/doc/publications/385.pdf

... In recent years among methods for analysis of a genomic data, more interest is attracted to alignment-free methods for comparing samples based on work with k-mers (oligonucleotides of length k, also called l-tuples or n-grams) directly from metagenomic reads. ... 2012) A metagenome-wide association study of gut microbiota in type 2 diabetes, Nature, 7418: 55­60. ... 2010) A human gut microbial gene catalogue established by metagenomic sequencing, Nature, 7285: 59-65. ...

Еще в разделе: (Показать все результаты (>101) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/200.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/235.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/144.pdf

О факультете . ... Психологи МГУ . ... Правила приема на факультет психологии МГУ . ... The V Congress of the Russian Psychological Society . ... Self-Assessed Intelligence, Personality, and Psychometric Intelligence: Preliminary Validation of a Model with a Selected Student Population . ... System Anthropological Psychology: Methodological Foundations . ... The Psychophysiological Diagnostics of the Functional State of the Athlete. ... Moral Judgments of Modern Children and Teenagers in Russia . ...

Еще в разделе: (Показать все результаты (>2402) - www.psy.msu.ru/ )

• Complete list of audiotapes of the Library of Psychological Literature in
• Аудиотека библиотеки психологической литературы им. В.В. Лучкова
• Руководство факультета

... Nature, 1920, Vol. ... 2002-2005, JFM, 2005, Vol . 529) i- : d dt (t ) i d 0, d dt (t ) i v i d Pin d (t ) (t ) i Fi d Pij d (t ) : Pin ­ i, Pij ­ i j - ­ - ­ - dv f St 6 ( v v s ) f A s g (Maxey M.R., Riley J.J., 1983): dt dv d s v s f vm s dt dt ds vs m dt f St f A fvm f BB mg f BB 6 2 0 t d s ( v v s ) dt1 t t dt1 1 : : vs ­ ms ­ ­ c ­ s ­ v ­ ­ ­ : U ­ L ­ cm ­ lt ­ m g (1 ) mU U s , lt s 6 6 c div (cv s ) 0 t ... A=6000 . A=600 =/6. ...

Еще в разделе: (Показать все результаты (>4) - lab110.imec.msu.ru/ )

... Публикации . ... Vassiliev, Dmitrii V. Glukhov, Galina A. Tsirlina, Michael Probst . ... Galina Tsirlina, Evgeny Antipov, Dmitrii Glukhov, Alexander Gusev, Veronika Laurinavichute, Renat Nazmutdinov, Dmitry Simakov, Sergey Vassiliev, Tamara Zinkicheva . ... Sergey Vassiliev, Veronika Laurinavichute, Zoya Kuz'minova, Galina Tsirlina, Evgeny Antipov, Alexander Gusev, Dmitry Simakov . ... Кристаллохимические и электрохимические аспекты исследования проблемы "интертного" анода . ...

Еще в разделе: (Показать все результаты (>2) - www.alumina.chem.msu.ru/ )

PHP Manual . ... Next . 3.0.6 - 3.0.18 only, PHP 4 >= 4.0.0) mysql_db_name -- Get result data . ... mysql_db_name() takes as its first parameter the result pointer from a call to mysql_list_dbs() . ... If an error occurs, FALSE is returned. ... Example 1. mysql_db_name() example . php error_reporting(E_ALL); mysql_connect('dbhost', 'username', 'password'); $db_list = mysql_list_dbs(); $i = 0; $cnt = mysql_num_rows($db_list); while ($i < $cnt) { echo mysql_db_name($db_list, $i) . ...

Еще в разделе: (Показать все результаты (>22) - oit.cmc.msu.ru/ )

• GNU Readline
• Accessing Arguments

... Stanley Milgram SIX DEGREES OF SEPARATION OR SMALL WORLD PHENOMENON 1998, Small world networks Steven Strogatz Duncan Watts Laszlo Barabasi and Reka Albert 1999 In 1999 American physicits Barabasi and Albert have shown that distribution of nodes by the number of links in tke most real networks is described by power law and they called such networks as scale-free networks Reprinted from Linked: The New Science of Networks by Albert-Laszlo ... Human disease network. ... disease ­ , ). ...

Еще в разделе: (Показать все результаты (>8) - www.soc-phys.chem.msu.ru/ )

• http://www.soc-phys.chem.msu.ru/rus/prev/zas-2013-10-01/presentation.pdf

Leonid V. Pugolovkin . Recent papers (2009 - 2013) . ... Pugolovkin L.V., Naumova M.A., Fedorova A.A., Borzenko M.I., Tsirlina G.A. Half-wave potential as affected by supporting electrolyte nature:Interplay of adsorption and ionic association for electroreductionof V(V)-mixed addenda Keggin tungstophosphate. ... Acta, 2013. ... Pugolovkin L.V., Vassiliev S.Yu, Borzenko M.I., Laurinavichyute V.K., Tsirlina G.A. Speciation in strongly acidic metastable solutions of oxotungstate(VI) compounds. ...

Еще в разделе: (Показать все результаты (>99) - electr003.chem.msu.ru/ )

• Maria A. Choba:CV
• Elena V. Stenina:CV
• Galina A. Tsirlina

Title Authors The specificity of female deviance in Tsaritsyn in the end of XIXth ­ beginning of XXth centuries Avstrijskov E.V., Sukhova A.V., Selezneva I.G. modernization, women's deviant behavior , anomie , personal disorganization, marginalization, economic stability, social norm, the economic crisis, behavioral expectations, social welfare In this work there were analyzed the nature and specifics of female ...

Еще в разделе: (Показать все результаты (>31) - www.socio.msu.ru/ )

• Вестник МГУ

... Workload balancing in GPU implementation of breadth-first search" . Chernoskutov M.A., Ermakov D.G. Parallel processing of unstructured data єѓ¶Иє®¶Г¶В in a graph-like form can be a severe computational challenge because of significant overheads caused by the irregular nature of graph algorithms and the hardware latency of intensive data access. ... Keywords: breadth-first search, parallel algorithm, graphics processing units . PDF (in Russian) (315KB) . PDF. zip (in Russian) (275KB) . ...

Еще в разделе: (Показать все результаты (>23) - num-meth.srcc.msu.ru/ )

• "Development and implementation of numerical algorithms for solving the
• "On the path coding of k-faces in an n-cube"

Переход к основной странице * Учебная работа * Курсовые и дипломные работы * Студенты кафедры . ... Рецензент: ст. преп. ... Участие активных форм кислорода в физиологических ответах корня Arabidopsis thaliana (L.) Heynh на солевой стресс' . ... Влияние семян и проростков Impatiens gladulifera Royle на архитектуру корневой системы Arabidopsis thaliana (L.) Heynh.' Influence of seeds and seedlings of Impatiens gladulifera Royle on root architecture of Arabidopsis thaliana (L.) Heynh." ...

Еще в разделе: (Показать все результаты (>35) - plantphys.bio.msu.ru/ )

Particle pair production in strong EM field, Imaginary temperature and field emission Boris Levchenko SINP MSU, Moscow Tunneling processes (Nature, adv. technologies) Electron field emission from metals: quantum theory by Fowler and Nordheim Results by Sauter and Schwinger for electric field in vacuum Condensed matter .vs. ... QFTHEP'10, BB Levchenko Pair production 16 Scheme of probing strong-field QED in the collisions of a 50-GeV electron beam with a focused laser beam. ...

Еще в разделе: (Показать все результаты (>42) - qfthep.sinp.msu.ru/ )

2002 . H.Oppermann, P.Shmidt, M. Zhang-Presse, H.Dao Quoc, H.Kucharkovi, B.A.Popovkin, V.A.Dolgikh, S.A.Ibragimov Untersuchungen zum System BiOBr/SeO 2 // Z. Anorg. Allg. Chem, 2002, B. 628, S. 91-99 . M.E.Omari, J.M.Reau, J.Senegas, T.V.Serov, E.I.Ardashnikova, V.A.Dolgikh The nature of anionic clusters in anion excess fluorite-type oxidefluoride solid solutions in MF-BiF 3 -BiOF systems (M = Na, K) // Journal of Fluorine Chemistry 2002, v.113, p. 37-46 . ... Chem. ... Z. Anorg. ...

Еще в разделе: (Показать все результаты (>65) - www.inorg.chem.msu.ru/ )

• Сотрудники - Лаборатория Химии Координационных Cоединений
• Inorganic Synthesis Laboratory people
• Кафедра неорганической химии Химического факультета МГУ им. М.В. Ломоносова

... http://www.mmonline.ru/message/2336/ . ... Саламандры умеют считать до трех . ... Это позволяет предположить, что способность проводить различия между небольшими количествами предметов возникает в процессе эволюции намного раньше, чем считали ученые, сообщает Nature (перевод на сайте Inopressa.ru). ... Существует предельное количество предметов, за которыми можно следить одновременно", - объясняет Ален Лесли, который исследует развитие человеческого мозга в Университете Рутжерса, штат Нью-Джерси. ...

Еще в разделе: (Показать все результаты (>150) - www.mmonline.ru/ )

• MMOnline | Новости | Новый научный журнал
• Новый научный журнал

... В престижнейшем научном журнале Nature опубликована работа ученых из Франции и США (Jean-Pierre Luminet и др.), посвященная вопросу экспериментального определения топологии нашей Вселенной. Согласно выводам авторов статьи наша Вселенная конечна и имеет додекаэдральную топологию. ... Если вселенная конечна, то лучи света будут описывать сложные траектории, даже возвращаться в точку излучения. Возникнут несколько изображений одного и того же источника. ...

Еще в разделе: (Показать все результаты (>215) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/review/cosmo2003/popov01.txt
• http://xray.sai.msu.ru/~polar/sci_rev/1503.html
• http://xray.sai.msu.ru/~polar/sci_rev/0704.html

... Copyright @ 2003 by Humana Press Inc. All rights of any nature whatsoever reserved. 0273-2289/03/ 109 /0001/$20.00 f I Introduction SERGEY 1 v. KAlYUZHNYI*,1 AND PETER WEIlAND2 Department of Chemical Enzymology, Chemistry Faculty, Moscow State University, 119992 Moscow, Russia ; and 2Federal Agricultural Research Centre, Institute of Technology and Biosystems Engineering, 38116 Braunschweig , Germany The series of ... The 8th FAO /SREN workshop is scheduled for 2005in Uppsala, Sweden. ...

Еще в разделе: (Показать все результаты (>115) - www.enzyme.chem.msu.ru/ )