q| PDB : 1r51 :A| PDB : 1auz :A URATE OXIDASE FROM ASPERGILLUS FLAVUS COMPLEXED WI savkaarygkdnvrvykvhkdektgvqtvyEMTVCVLLEGEIetsytkadnsvivatdsikntiyitakq npVTPPELFGSILGTHFIEKYN-HIHAAHVNIVChrwtrmdidgkphphsfirdseeKRNvqvd------ ------vveGKGIDIKSSlsgltvlkstnsqfwgflrdeyttlketwdrilstdvdATWQW-------KN FSglqevrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkhyfei dlswhkglqntgknaevfapqsdpnglikctvgrs t| PDB : 1auz :A| PDB : ...

Еще в разделе: (Показать все результаты (>310) - kodomo.cmm.msu.ru/ )

• Банк MedLine (PubMed)
• DNA-protein contacts

... Alexander A. Moskovsky . ... Software Designer : . ... Projects: . Janitor II, Custodian III for Matrix Logic - utilities for DOCS Open EDMS (electronic document management system), C++/Win32 platform. ~2 man-year project with 5 persons team. iBuzz - (for ibuzz.com ) large client-server system (Win32, Enterprize Java Beans, Oracle, Sun/Solaris). ... Lunch Ordering Web System. ... Software Resources International , former Digital Moscow Software Center, . ... Physical Chemistry chair, . ...

Еще в разделе: (Показать все результаты (>8) - lcc.chem.msu.ru/ )

• People

... The nonlinearity has the form of a sigmoid function of two parameters a and b. The zoning of the plane (b; a) with respect to the number and type of stationary states (critical points) for the model under consideration is performed. ... The function g(u) (called a shot function) is expressed by g(u; a; b) = 1 1 + a exp(\Gammabu) (2) where the parameters a and b are positive. ... Analysis of critical points. ... The center­type stable critical points correspond to a minimum of the function U (u) [3]....

Еще в разделе: (Показать все результаты (>41) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/6.htm
• http://num-anal.srcc.msu.su/list_wrk/ps/b1_47.ps
• Обыкновенные дифференциальные уравнения

DNS Security, Stability and Resiliency John Crain Chief Technical Officer April 21st 2009 Garmisch 1 Monday, 20 April 2009 Agenda · The Global DNS SSR Symposium · Problems and Opportunities · Questions? ... The level of awareness with respect to the DNS is very low" ­ All quotes from Symposium Report 7 Monday, 20 April 2009 Problems & Opportunities 8 Monday, 20 April 2009 Problem: · There is a need for training across all sectors of the industry to raise both skills and awareness. ...

Еще в разделе: (Показать все результаты (>6) - iisi.msu.ru/ )

... The applied mathematics (with Honors), Kazan State University, Kazan, Russia (USSR), 1980. nd Alexander Lazarev Research Interests Discrete optimization: combinatory problems, modeling, decomposition algorithms, applications to production planning and scheduling. ... Kazan, Publishing house of the Kazan mathematical society, 1998. - 285 p. Lazarev A.A., Gafarov E.R. Scheduling Theory. ... Computer centre of the Russian Academy of Sciences - 2006. - 134 p. Lazarev A.A., Gafarov E.R. Scheduling Theory...

Еще в разделе: (Показать все результаты (>3) - physcontrol.phys.msu.ru/ )

... Optical Zoomeron as a Result of Beatings of the Internal Modes of a Bragg Soliton B. I. Mantsyzov Faculty of Physics, Moscow State University, Vorob'evy gory, Moscow, 119992 Russia e-mail: mants@genphys.phys.msu.ru Received June 22, 2005; in final form, July 12, 2005 A new solution of two-wave MaxwellнBloch equations has been obtained analytically and numerically. ... The absence of losses on the emission of continuous spectrum waves indicates that the solutions found for the internal mode are...

Еще в разделе: (Показать все результаты (>28) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/6.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/7.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/10.pdf

... Brykina I. G. Methods for calculation of heat transfer and skin friction in 3D hypersonic laminar flow over bodies at all Reynolds numbers. ... Sakharov V. I. Simulation of nonequilibrium viscous gas flows in induction plasmatrons and over bodies. ... Shcherbak V. G. Numerical study of nonequilibrium air flow over bodies. ... Tirskiy G. A. Destruction of solid bodies in the hypersonic gas flow. ... Rusakov V. V. Analytical and numerical investigation of 3D viscous flow over blunt bodies. ...

Еще в разделе: (Показать все результаты (>8) - lab106.imec.msu.ru/ )

P.G.Grinevich: List of publications 1. ... Anal. i ego Pril., 1982, v.16, No 1, pp. 19­24 (in russian); English translation: Funct. ... Novikov S.P., Grinevich P.G. About the spectral theory of commuting operators of rank 2 with periodic coefficients. ... English translation: Soviet Math. ... Anal. i ego Pril., 1985, v. 19, No 4, pp. 32­42 (in russian); English translation: Funct.Anal.Appl., 1985, v.19, pp. ... Anal. i ego Pril., 1986, v. 20, No 1, pp. 14­24 (in russian); English translation: Funct. ...

Еще в разделе: (Показать все результаты (>67) - higeom.math.msu.su/ )

• Publications (English)
• Publications (Russian)
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/UchProcess-2011

... Магистерское образование . ... Enterprise Information Infrastructure . This course is focused on enterprise infrastructure and integration technology. Course presents different approaches to enterprise architecture and modern solutions of information infrastructure problems. Course?s topics cover strategies that help large enterprises to increase the agility of their IT systems. ... Enterprise portal technology, including collaboration and knowledge management . ... FI- Master data . ...

Еще в разделе: (Показать все результаты (>6) - hcs.cmc.msu.ru/ )

• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

University Satellites and . Space Science Education . ... Simulation of Carrier Phase GPS Observables and Feasible Attitude Determination Algorithms for Universitetskiy-Tatyana Satellite . ... Carrier phase observables of radio signals transmitted by navigation satellites, when obtained from multiple antennas, potentially could provide the most accurate and stable solution for attitude determination among other methods. ...

Еще в разделе: (Показать все результаты (>9) - cosmos.msu.ru/ )

I NSTITUTE OF PHYSICS PUBLISHING PHYSICAL B IOLOGY Phys. Biol. 3 (2006) 121­129 doi:10.1088/1478-3975/3/2/004 Direct simulation of plastocyanin and cytochrome f interactions in solution I B Kovalenko1,AMAbaturova1, P A Gromov2,DMUstinin1, E A Grachev2, G Yu Riznichenko1 and ABRubin1 1 2 ... 2006 Online at stacks.iop.org/PhysBio/3/121 Abstract Most biological functions, including photosynthetic activity, are mediated by protein interactions ... We use this structure in our simulation. ...

Еще в разделе: (Показать все результаты (>29) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3333.pdf
• http://library.biophys.msu.ru/PDF/3329.pdf

ITU_OTN_Tutorial.pdf 21-Sep-2015 08:03 596526 adv_networks_openflow_tasks15.pdf 26-Nov-2015 11:15 1060860 calculus_assignment_2015.xlsx 09-Dec-2015 16:18 11628 network_calculus_task.docx 09-Dec-2015 16:18 308532 network_calculus_task.pdf 09-Dec-2015 16:18 1417494 solution_template.docx 09-Dec-2015 16:18 20487 titul.doc 11-Sep-2015 10:41 32768 ДГКС_1_задание.pdf 27-Nov-2015 10:09 37219 Итоговая_таблица_на_5.01.16.xls 11-Jan-2016 15:04 33280 Темы_Литература_Требован?. ... 21-Sep-2015 08:02 3940552 . ...

Еще в разделе: (Показать все результаты (>4) - lvk.cs.msu.su/ )

... Seminar archive . ... It is shown that the magnetodipole radiation from the rotating magnetized neutron star must penetrate into its conducting crust. ... For the finite conductivity the solution of the electrodynamic equations is the wave propagating from the neutron star surface to the core where the electric field in rotating frame is not equal to zero. Such electric field excites the electric currents and the tangential magnetic field of the large amplitude. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>3) - master.sai.msu.ru/ )

A full system of equilibrium differential equations for the finite number of suspension lines (n = 28) of square parachute is derived. ... One can determine the shapes of inflated canopy radial cross-sections, stress distribution of radial ribbons on the canopy surface and fabric stress between them, drag coefficients for various line lengths and air-permeability by means of computer simulation. ... Initially, this problem was solved assuming D p = const over total canopy of square parachute. ...

Еще в разделе: (Показать все результаты (>3) - margaret.imec.msu.ru/ )

• Pressure Distribution Peculiariry Along Square Canopy
• Large-Scale Load Stabilization

Confirmation of the 1-+ Meson Exotics in the 0 System G. S. Adams,1 T. Adams,2 , Z. Bar-Yam,3 J. M. Bishop,2 V. A. Bodyagin,4 , D. S. Brown,5 , N. M. Cason,2 S. U. Chung,6 J. P. Cummings ... Department of Physics, University of Massachusetts Dartmouth, North Dartmouth, Massachusetts 02747 4 Nuclear Physics Institute, Moscow State University, Moscow, Russian Federation 119899 5 Department of Physics, Northwestern University, Evanston, Il linois 60208 6 Physics ... The quality of the fits is good. ...

Еще в разделе: (Показать все результаты (>36) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/Exotic_mes_etap_12_Oct_2004.pdf
• http://lav01.sinp.msu.ru/~vlk/report_E852.ps

MOSCOW MATHEMATICAL JOURNAL Volume 1, Numb er 3, July­Septemb er 2001, Pages 407­419 STEADY SOLUTIONS FOR FIFO NETWORKS K. KHANIN, D. KHMELEV, A. RYBKO, AND A. VLADIMIROV Dedicated to Robert Minlos on the occasion of his 70th birthday Abstract. We consider the fluid model of a reentrant line with FIFO discipline and look for solutions with constant flows (steady solutions). ... Kelly networks, fluid models, uniqueness of steady solution, fixed points. ... Let x = N x be a fixed point of N . ...

Еще в разделе: (Показать все результаты (>26) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

ANCIENT AND EARLY MEDIEVAL ECLIPSES IN EUROPEAN SOURCES . ... J.K.Fotheringham, A Solution of Ancient Eclipses of the Sun, Mon. ... R.R.Newton, Ancient astronomical observations and the acceleration of the earth and moon, The Johns Hopkins University Press, 1970 (R.R.Newton, 1970) . ... F. R. Stephenson, Historical Eclipses and Earth's Rotation, Cambridge University Press, 1997. ... Plutarch, "Romulus" . ... The solar eclipse observed by the poet Archilochus . ... The eclipse observed by Plutarch . ...

Еще в разделе: (Показать все результаты (>54) - hbar.phys.msu.ru/ )

• Гинцель
• The jump of the second derivative of the moon's elongation

... It was found that CNT-based filters are efficient for the adsorption of heavy metals from aqueous solution. DETERMINATION OF THE NI (Tl) DETECTOR EFFICIENCY USING RADIOACTIVE PARALLELEPIPED SOURCES Mohamed S. Badawi1), Mona M. Gouda1), Ahmed M. El-Khatib1), Mohamed A. Elzaher2), Abouzeid A. Thabet3), Ahmed A. Salim1) and Mahmoud I. Abbas1) 1) Physics Department , Faculty of Science, Alexandria University , 21511 Alexandria, Egypt , 2) Department of Basic and Applied Sciences, ...

Еще в разделе: (Показать все результаты (>98) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/pci2012/vecher29_stend.pdf

Proceedings of ICHIT- 06 26 February - 5 March 2006, Moscow, Russia LINEAR AND NONLINEAR ANALYSIS OF NUMERICAL METHOD FOR DNS OF TURBULENT CONVECTION IGOR B. PALYMSKIY Modern Academy for Humanities, Novosibirsk Branch , Novosibirsk, Russia, 630064 palymsky@hnet.ru Abstract We study the spectral characteristics of the numerical method for DNS of turbulent convectional flows. ... So far the full numerical simulation of 3-D turbulent convection is very complex problem demanding the large resources. ...

Еще в разделе: (Показать все результаты (>9) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2006/CD/Palymskiy2.pdf
• http://hit-conf.imec.msu.ru/2006/CD/Palymskiy1.doc
• http://hit-conf.imec.msu.ru/2006/CD/Palymskiy1.pdf

... Equivalent models. 3 prl = l ,clay K pclay C clay 1 + l ,s (K ps - C clay ) , (3) and at Kps < C clay prl = l ,clay 1 K pclayC (4) clay where prl - resistivity of rock consisted of a sand - clay mix at parallel connection of capillaries; l,clay ­conductivity of a liquid in clay capillaries; l,s - conductivity of a liquid in sand capillaries; Kpclay - clay porosity; Kps - sand porosity; clay - volumetric clay content in a sandy-clayish mix. ... The code of curves - volumetric clay content and...

Еще в разделе: (Показать все результаты (>22) - geophys.geol.msu.ru/ )

• http://geophys.geol.msu.ru/shevnin/publ/180.pdf