Annotation to the diploma of Aleksei Konjashkin Peculiarities of generation and amplification of diode pumped Nd:YAG picosecond laser The aim of diploma is the estimation of focal length of thermal lens arising in active element depending from the diode pump pulses rate and energy. ... The next aim was the calculation and adjustment of compact two pass amplifying system and comparison of the characteristics of two amplifiers of picosecond pulses with lamp and diode pump. ...

Еще в разделе: (Показать все результаты (>63) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Kostylev_Cherezova_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Grinenko_Morozov_en.pdf

... We live in the epoch of modern informational, scientific and intellectual technologies. Modern person, especially young one, cannot imagine life without computers, cellular phones and high-speed Internet. ... History has given a lesson - having splendid science, excellent education and highly organized society, having colossal resources, being a great power, we could not cope with the task - to build a prospering and just society. ... It demonstrates the colossal possibilities of modern science. ...

Еще в разделе: (Показать все результаты (>34) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/525.doc
• http://www.rsr-online.ru/doc/norm/242.doc

... Kalyuzhnyi S. and Fedorovich V. (1997) Integrated mathematical model of UASB reactor for competition between sulfate reduction and methanogenesis. ... Kalyuzhnyi S.V. and Fedorovich V.V. (1998) Mathematical modeling of competition between sulphate reduction and methanogenesis in anaerobic reactors. ... Kalyuzhnyi S., Fedorovich V., Lens P., Hulshoff Pol L., Lettinga G. (1998) Mathematical modeling as a tool to study population dynamics between sulfate reducing and methanogenic bacteria. ...

Еще в разделе: (Показать все результаты (>144) - www.enzyme.chem.msu.ru/ )

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>175) - ee-journal.spa.msu.ru/ )

FEATURES OF THE HYDROGEN DISTRIBUTION AROUND LUNAR CRATERS PROCLUS AND KEPLER. ... In result of analysis of the data Lawrence and Feldman constructed the hydrogen distribution on the lunar surface [1]. ... However, the authors shown, that EN flux data features may be explained by other element abundance in the lunar soils, namely: Si, Ca, Gadolinium (Gd), Samarium (Sm) and Fe. ... Using of the Feldman's interpretation of the Lunar Prospector data [8], we constructed hydrogen distribution map (Fig.1). ...

Еще в разделе: (Показать все результаты (>90) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Rod/Publications/ms40/21_Dolitsky_etal.pdf
• http://selena.sai.msu.ru/Ber/Publications/ms40/88_Yamashita%20et_al.pdf
• http://selena.sai.msu.ru/Chik/Publications/ms42/m42_12.pdf

... 7­8, 2000 UDC 620.18:65.012.12.001/002 REPRODUCIBILITY OF THE STRUCTURE AND PROPERTIES OF PARTS AND THEIR DESCRIPTION WITHIN THE FRAMEWORK OF NONLINEAR DYNAMICS A. Yu. ... The problem of the reproducibility of complex structures is discussed from the standpoint of the applied theory of dynamic systems. ... The problem of the reproducibility of complex structures that appear in nonlinear media has become closely connected with some problems of the applied theory of dynamic systems. ...

Еще в разделе: (Показать все результаты (>66) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/prokhorov/phd/phd.htm
• http://chaos.phys.msu.ru/loskutov/PDF/TMPh_quadratic_cml.PDF
• http://chaos.phys.msu.ru/prokhorov/phd/tmf_eng.pdf

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

Chalkina N.A. Inertial Manifold for a Hyperbolic Equation with Dissipation . ... Sheipak I.A. Spectrum of a Jacobi Matrix with Exponentially Growing Matrix Elements . Sergeev I.N. Oscillation and Wandering of Solutions to a Second Order Differential Equation . Bednov B.B. Steiner Points in the Space of Continuous Functions . ... Kombarov Yu.A. The Minimal Circuits for Linear Boolean Functions . ... Kolyada S.S. Unit Checking Output Tests under Constant Faults for Functional Elements . ...

Еще в разделе: (Показать все результаты (>129) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

1995, Biochemistry, 60, 8, 923-928. ... Basic server procedures are dedicated to homology (similarity) search of sequence and 3D structure of proteins. The homologies found could be used to build multiple alignments, predict protein and RNA secondary structure, and construct phylogenetic trees. In addition to traditional methods of sequence similarity search, the authors propose "non-matrix" (correlational) search. ... RNA Secondary Structure Prediction Based on Sequence Alignment . ...

Еще в разделе: (Показать все результаты (>187) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank
• GeneBee BLAST 2.2.22+ Services Help

Стратегия здравоохранения относительно загрязнения питьевой воды мышьяком, марганцем, ураном и другими ядовитыми элементами в Западном Бангладеш. ... Для более чем 60 000 000 жителей Бангладеш питьевая вода представляет опасность, так как содержит большие концентрации загрязняющих веществ. ... Исследованы источники питьевой воды в различных регионах западного Бангладеш на содержание мышьяка, бора, бария, хрома, урана и др. химических элементов. ...

Еще в разделе: (Показать все результаты (>7) - ecoinformatica.srcc.msu.ru/ )

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

FAQ: QUESTIONS ASKED BY NOVICE USERS (c) Australian Geological Survey Organisation 1999-2002 (c) Yuri Shvarov 1999-2002 Last updated: 3 May 2002 This file does not substitute for the comprehensive HCh documentation. ... 2 UNITHERM USAGE 2.1 UNITHERM DATABASE 2.1.1 What is the guaranty that the included UNITHERM database has no incorrect entries? ... User's Guide. ... You can speed up your calculations for aqueous systems in a "manual" calculation mode of GIBBS when using Blank or Input files. ...

Еще в разделе: (Показать все результаты (>54) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/GibbsLib.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/Unitherm.doc
• Faculty of Geology >> Departments

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )

... A Combined Iterative Transform Method for Wave Propagation in Random Media . ... A method is presented to combine Fourier transform and finite elements for layers with randomly varying shear modulus. Fourier transform is applied to the horizontal direction. ... The assumption of a stochastic process of the shear modulus in the horizontal direction is new. ... The functional dependency on the transform coordinate leads to a loss of orthogonality of the Fourier transform. ...

Еще в разделе: (Показать все результаты (>114) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... The purpose of individualized education is to ensure that every student gains access to knowledge, skills and information that will prepare him/her to contribute to variety of communities and workplaces. ... In the USA there are some Schools of Individualized Study. ... That?s why we can describe the individualized study as the basis for introduction to the students? opportunities for self-discovery, diversity and flexibity of the curriculum, creativity and academic exellence. ...

Еще в разделе: (Показать все результаты (>141) - www.prof.msu.ru/ )

• Internationalizing Education In Barnaul State Pedagogical University
• Welche Rolle spielen internationale Erfahrungen bei der Entwicklung einer
• About the importance of founding teleecommunication centres in developing areas

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>209) - www.geogr.msu.ru/ )

• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• CONTENTS ? 1 - 2012
• ФОТОКОНКУРС 'ОБЪЕКТИВНАЯ ГЕОГРАФИЯ 2011'. ИТОГИ

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . On mathematical creative work of L.S. Pontryagin (By D.V. Anosov) . ... L.S.Pontryagin, P.S.Alexandrov and A.N.Kolmogorov . ... Photo by A.I.Pontryagina In the beginning of the 50s, L.S. went into (broadly understood) theory of ordinary differential equations, which had episodically drawn his interest earlier. ...

Еще в разделе: (Показать все результаты (>14) - pont2008.cmc.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

• Times of minima(maxima) calculator