UNDERSTANDING SPOKEN DISCOURSE: THE CONTRIBUTION OF THREE INFORMATION CHANNELS 1 Andrej A. Kibrik (Institute of Linguistics, Russian Academy of Sciences, kibrik@comtv.ru) Ekaterina M. хl'bert (CJSC GLITNIR Securities, ekaterina_elbert@inbox.ru) Modern linguistics generally presumes that linguistic form is a sequence of phonological segments. ... We thus tentatively split all elements that can possibly convey information in discourse into three channels: visual, prosodic, and verbal (=segmental). ...

Еще в разделе: (Показать все результаты (>327) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.pdf
• http://www.philol.msu.ru/~discours/images/stories/miscellanious/questions.doc

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... 1999 Inorganic chemistry of the dissolution phenomenon: the dissolution mechanism of calcium apatites at the atomic (ionic) level . Dorozhkin S.V. в журнале Comments on Inorganic Chemistry , издательство Taylor & Francis (United Kingdom) , том 20, ? ...

Еще в разделе: (Показать все результаты (>836) - istina.msu.ru/ )

• Downie S.R. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Takahashi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• DNA sequence : the journal of DNA sequencing and mapping - журнал | ИСТИНА -

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

... Физика атомного ядра и частиц" . Физика ядра и частиц. ... Программа курса "Физика ядра и частиц " . ... Семинары по физике ядра и частиц . ... Мир атомных ядер . ... 12 лекций по физике атомного ядра . ... Атомные ядра. ... Физика атомного ядра и частиц в УФН . ... Физика атомного ядра и частиц в Физической энциклопедии . ... Мы были бы признательны за ваши замечания и предложения, особенно признательны тем, кто согласится сотрудничать в подготовке материалов по физике частиц и атомного ядра. ...

Еще в разделе: (Показать все результаты (>135) - nuclphys.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . You may download the latest source code distribution and install the period search service at your own web server. ...

Еще в разделе: (Показать все результаты (>3) - scan.sai.msu.ru/ )

... Work of a system constructing the exercises with the help of a teacher is described. Algorithms of fragmentation of sound data into phonemes and of analysis of correctness of pronunciation of a student are suggested. ... The authors offer the functioning variant of a system, making it possible to a student to appreciate objectively a degree of correctness of his pronunciation, to classify errors and to listen to a difference of pronunciations of incorrect sounds interactively. ...

Еще в разделе: (Показать все результаты (>55) - www.intsys.msu.ru/ )

• Intelligent Systems :: Teaching :: Seminars :: Список специальных семинаров
• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>8) - swx.sinp.msu.ru/ )

. Загружено: Vovez . Дата загрузки: 05.03.2010 . Размер: 77.6 Кбайт . Подпись: no comments . Описание: ...

Еще в разделе: (Показать все результаты (>6) - www.dubinushka.ru/ )

All your comments please send to Yagola Anatoly ( yagola@prof.msu.ru ) or to web-deseigners of the site ( ill-posed@mail.ru , nataschka_@mail.ru ).

Еще в разделе: (Показать все результаты (>70) - foroff.phys.msu.ru/ )

Physics ± Uspekhi 58 (12) 1220 ± 1222 (2015) LETTERS TO THE EDITORS #2015 Uspekhi Fizicheskikh Nauk, Russian Academy of Sciences PACS numbers: 05.45. ± a, 45.40. ± f Notes on new friction models and nonholonomic mechanics A V Borisov, I S Mamaev DOI: 10.3367/UFNe.0185.201512g.1339 Abstract. ... Using recent results as examples, it is shown that the validity and potential of the nonholonomic model are not inferior to those of other dynamics and friction models. ... 226 2831 (2015) Borisov A et al. ...

Еще в разделе: (Показать все результаты (>120) - ics.org.ru/ )

• Institute of Computer Sciences - Publications

The use of the external module Ab_An.dll Ab_An.dll file is an external module for the Gibbs program, and is designed to calculate the activity coefficients of the components of albite- anortite solid solution. ... A non-ideal model of albite-anortite solid solution, proposed in literature [1], is used in this module. ... Preparation of the System file To be able to use the module Ab_An.dll, you need to include a binary solid solution of albite and anortite into the System file, as you create it. ...

Еще в разделе: (Показать все результаты (>56) - www.geol.msu.ru/ )

• http://www.geol.msu.ru/deps/geochems/soft/en/Electrum.doc
• http://www.geol.msu.ru/deps/geochems/soft/en/ZnS_FeS.doc
• Download Yuri Shvarov's files

High-Quality Spatial Interpolation of Interlaced Video Alexey Lukin Laboratory of Mathematical Methods of Image Processing Department of Computational Mathematics and Cybernetics Moscow State University, Moscow, Russia lukin@graphics.cs.msu.ru Abstract Deinterlacing is the process of converting of interlaced-scan video sequences into progressive scan format. ... The proposed spatial interpolation algorithm is used as a part of a motion-compensated video deinterlacing method. ...

Еще в разделе: (Показать все результаты (>216) - imaging.cmc.msu.ru/ )

• Software projects | Laboratory of Mathematical Methods of Image Processing

user_corner ]] . CompHEP . Trace: user_corner . CompHEP users are invited to write their proposals and comments. ... Community contributions . Community model library . ... License . ... Installation guide . ... CompHEP-3.3 Manual . CompHEP-3.3 Manual (pdf) . ... user_corner.txt Last modified: 2008/06/26 13:25 by dubinin . Except where otherwise noted, content on this wiki is licensed under the following license: CC Attribution-Noncommercial-Share Alike 3.0 Unported . ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• news [CompHEP]
• extra:main [CompHEP]
• tutorials [CompHEP]

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>50) - brain.bio.msu.ru/ )

• Nonparametric approaches to the description of EEG piecewise stationary
• Change-points in EEG components with different pattern
• Change-point synchronization between signals or signal components

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. ... April 11, 2013 - Bashneft Group in conjunction with JSFC "Sistema" opened the programme for the development of key Bashneft Group management - School of CEOs, "Capsule of security". ... At the end of his Welcoming Speech President of Bashneft Group stressed that this programme ? ... The School of CEOs ? ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>17) - hsmi.msu.ru/ )

... To create a Hysteresys calibration file user should do the following: . Nodal points with known distances between them should be marked using poly line (Curve) on the obtained image of a calibration sample. ... Figure 2.12: Table that allow to define points that are needed for calibration plots generation. ... In this case user should obtain two separate calibration files for fast and slow scanning direction(x-calibration Х y-calibration-slow). ... Then we should unite these two files in one. ...

Еще в разделе: (Показать все результаты (>102) - www.spm.genebee.msu.ru/ )

• COM-port initialization file format
• FemtoScan Online FAQs
• File Text Headings Viewing

Plyashechnik A.S. Equivalence of Two Definitions of a Chronological Integral . ... Chirskii V.G. Algebraic Independence over Q p of Values of Analytic Functions at Points from C p . ... Brovko G.L. Models and Problems for Saturated Porous Media . Georgievskii D.V. Growth Estimates of Perturbations in Eigenvalue Problems for the Rayleigh Equation . ... Index of papers and matherials published in the Journal "Vestnik Moskovskogo Universiteta. ... 1, Matematika. Mekhanika" during 2010 year . ...

Еще в разделе: (Показать все результаты (>159) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2011

... In this paper we present a technique for authorship attribution based on a simple Markov chain of letters (i.e., just letter bigrams are used). ... We show that this technique provides excellent results when applied to over 380 texts from the Project Gutenberg archives, as well as to two previously published data sets. ... They examine the proportion of function words used by an author, and find that this is stable for each author, across a large number of writers in Russian. ... One Text . ...

Еще в разделе: (Показать все результаты (>62) - old.philol.msu.ru/ )

• TRUE WRITER RECOGNITION
• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship
• Using Literal and Grammatical Statistics\\ for Authorship Attribution

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

• "Урания" - Портал "Русский переплет" Soros Education Journal