... 10:00- 10:45 10:45- 11:30 Opening Ceremony Albert Nikolaevich Shiryaev, Steklov Mathematical Institute , RAS, Moscow , Russia Friedrich GЖtze, Bielefeld University , Germany Entropy Expansions in Probability Narayanaswamy Balakrishnan, McMaster University , Hamilton, Ontario, Canada Signatures Alexander Ivanovich Sakhanenko, Novosibirsk State ...

Еще в разделе: (Показать все результаты (>243) - en.cs.msu.ru/ )

• Invited lecture by Prof. Vijay Ganesh (University of Waterloo, Ontario, Canada)
• Laboratory of Industrial Mathematics | CMC MSU
• Send by email | CMC MSU

... Python . ... О UNИX . ... Known main issues with the Jabber bot . ... Supplemental to the basic email based notification you can use a separate process running a Jabber/XMPP notification bot. ... The bot can be used to send notifications about various events occuring in your Wiki, or to work with the Wiki interactively. ... The interactive Jabber bot allows to perform various simple operations on a Wiki from within your IM client (possibly in response to received notification). ... Python Powered . ...

Еще в разделе: (Показать все результаты (>250) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinWikiSyntax - UNИX
• HelpOnActions/AttachFile - UNИX
• FrBrGeorge/StudentServer/Deployment - UNИX

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>799) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

Brandenburg A., Sokoloff D., Subramanian K. Current status of turbulent dynamo theory: From large-scale to small-scale dynamos, eprint arXiv:1203.6195 (2012), 36 p. Several recent advances in turbulent dynamo theory are reviewed. High resolution simulations of small-scale and large-scale dynamo action in periodic domains are compared with each other and contrasted with similar results at low magnetic Prandtl numbers. ...

Еще в разделе: (Показать все результаты (>174) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Laboratory of Informatics
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>481) - www.geogr.msu.ru/ )

• CONTENT 1 (7) 2014
• gucci bags review or kem bags
• CONTENT 2а(5)а2012

... SAI MSU 20-21 March 2014 . ... Programme and presentations . ... Zel'dovich asteroid . ... YaB-100 conferences . ... 20 March . Chair V.M. Lipunov . ... Some unusual ideas in our books with Ya.B. Zel'dovich . ... Coffee break . ... Chair I.D. Novikov . ... Cosmoparticle physics - fundamental relationship of Cosmology and Particle Physics . ... Zel'dovich as the initiator of gravitational wave research (in Russia and in the world) . ... A.G. Doroshkevich . ... Chair A.G. Doroshkevich . ...

Еще в разделе: (Показать все результаты (>61) - master.sai.msu.ru/ )

• Master net

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years – for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Faculty of geography Lomonosov Moscow State University
• Recreational Geography and Tourism
• International conference «Bringing together Selenga-Baikal research”

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>205) - qfthep.sinp.msu.ru/ )

• June 26, 2015

... General astronomy . ... PHYSICAL CONSTANTS.. ... Nobel Laureates in Physics 1901-2002 . ... Lectures Astronomy-161 "Solar System" (Also it contains info about History of Astronomy) . ... The History of Science . ... College-Level Astronomy Courses - at American, Australian Universities and Colleges . ... Messier: . ... Science . ... Scientific American . ... JOURNAL OF COMPUTATIONAL PHYSICS . ... Scientific Journals . ... American Physical Society Journals: Physical Review, Review of Modern Physics ...

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... X-COM: Distributed Computing Software . ... In mellow autumn time Moscow cordially invites HPC specialists to take part in Russian Supercomputing Days, the brand new international supercomputing conference that unites several traditional Russian and international HPC events. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Russian Supercomputing Days International Conference . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• X-COM: DISTRIBUTED COMPUTING SOFTWARE | Moscow University Supercomputing Center
• MSU SUPERCOMPUTERS: IBM BLUE GENE /P | Moscow University Supercomputing Center
• Internships at MSU | Moscow University Supercomputing Center

... October 6, 09:00 09:40 . Jorge Melnick (ESO) . ... We present a statistical and temporal analysis of the ground meteorological properties recorded at the five selected sites for hosting the European Extremely Large Telescope (EELT). ... Marc Sarazin (ESO) . The organization and development of the E-ELT site testing campaign by ESO are described. ... The E-ELT Site Testing activities in northern Chile and Argentina are reviewed, and pioneering explorative campaigns are illustrated. ...

Еще в разделе: (Показать все результаты (>26) - site2010.sai.msu.ru/ )

• General information
• Observatories

J/AstL/vol/page SAI Open Clusters Catalog (Glushkova+, 2009) ================================================================================ Automated search for star clusters in large multiband surveys. ... Color excesses E(B-V), distance moduli and ages were determined for 141 new and 27 known, but poorly studied clusters. We present the Sternberg Astronomical Institute Open Clusters Catalog (SAI OCL Catalog) of coordinates, diameters and main physical parameters of these clusters. ...

Еще в разделе: (Показать все результаты (>4) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Publications

... Commision on Soil Genesis, IUSS . ... Institute of Geography, Russian Academy of Sciences, Moscow . Institute of Ecological Problems of the North, Ural Branch of RAS, Arkhangelsk . ... Dokuchaev Soil Science Institute, Moscow . ... Prof. Dr. G.V.Dobrovolsky (Russia, Dokuchaev SSS President) . ... Prof. Dr. F.N.Yudakhin (Russia, Arkhangelsk Scientific Centre President) . ... Prof. Dr. Yu.G.Kutinov (Russia, Arkhangelsk, Director, Inst. ... Conference Secretariat . ... IV CONFERENCE ON CRYOPEDOLOGY . ...

Еще в разделе: (Показать все результаты (>231) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Projects
• Commission Report of the Inter-Congress period 1999-2003
• Klumpen—a Mesoscale Level of Classification for Soil Structure: Rationale

XLVII , , : . 18 ­ 22 2011 . ­ .: , 2011. ­ .24 .. «ON OSCILLATING NUCLEAR REACTIONS IN NEUTRON STARS» S.I. Kuznetsov , Web- www.chronos.msu.ru e-mail: bitva@mail.ru , , . -, - .. [1] ( ), " ", . . , ( ) . . [2], , () (1015 ) , , , . - [3]. , . [1]. ., . . / . . .: , 1986. [2]. M. Bander, H. R. Rubinstein. Proton +-Decay in Large Magnetic Fields ­ arXiv: hep-ph/9204224v1 [3]. A. Nucciotti. Double beta Decay: Experiments and Theory Review ­ arXiv: nucl-ex/0707.2216v3

Еще в разделе: (Показать все результаты (>550) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/kiefer_fqx.pdf
• http://temporology.bio.msu.ru/cfp_2012.pdf
• OPEN CALL for Academic and Artistic Submissions

... After the edit, recompile the kernel and recompile the Apache server then reboot. ... Addendum for very heavily loaded BSD servers . ... If you're running a really busy BSD Apache server, the following are useful things to do if the system is acting sluggish: . ... Here are some BSD kernel config parameters (actually BSDI, but pertinent to FreeBSD and other 4.4-lite derivatives) from a system getting heavy usage. ... Rebuilding the FreeBSD kernel on an AMD-133 (486-class CPU) web-server with . ...

Еще в разделе: (Показать все результаты (>442) - rtm-cs.sinp.msu.ru/ )

• Compressed TCP/IP-Sessions using SSH-like tools
• Performance Tuning Tips for Digital Unix
• Qt Toolkit - QAsyncIO Class

... GENERAL INFORMATION Registration Registration forms will be available in January 2010 at: 20th Polymer Networks Group Meeting in Goslar , Germany, Aug. 29th ­ Sep. 2nd, 2010 Invited speakers (CEN Saclay, France) FranГois BouИ (CU Boulder, USA ) Christopher N. Bowman (University of Cambridge, UK) Wilhelm Huck (UDEL Newark, USA ) Kristi L. Kiick (UNC Chapel Hill, USA ) Michael Rubinstein (IPF Dresden, Germany) Jens-Uwe Sommer (UW Seattle, ... chemically reversible networks, ! ...

Еще в разделе: (Показать все результаты (>481) - polly.phys.msu.ru/ )

• http://poly.phys.msu.ru/en/news/attach/2011_10_11_Eupoc2012.pdf
• International Workshop "Theory and Computer Simulation of Polymers: New
• Seminar in Polymer Physics

Ф.Я.Халили родился 22 августа 1952. ... Темой научной деятельности Халили Ф.Я. является квантовая теория измерений, в том числе теория квантовых невозмущающих измерений и квантовая теория обнаружения и оценивания. ... Построена теория линейных квантовых систем с непрерывным измерением. ... V.B.Braginsky, F.Ya.Khalili, ``Quantum Measurement'', ed. by K.S.Thorne, 1992 . ... V.B.Braginsky, F.Ya.Khalili, ```Maxwell demon' in quantum non-demolition measurements'', Physics Letters A, v186 (1994) 15-17 . ...

Еще в разделе: (Показать все результаты (>95) - hbar.phys.msu.ru/ )

... Society . ... Library . ... The MNS library is one of Russia?s largest and contains about half a million books. The history of the library starts from the book collection of Fischer von Waldheim, the Society?s first director. ... D. Shelaputin, a merchant and the Society?s member, handed over more than 2,500 rare books to the library in 1831. ... 2015 Moscow Society of Naturalists . Developed with the assistance of "Novoe Sobranie" Fund in Aleksandr Golovkin?s web-studio. ...

Еще в разделе: (Показать все результаты (>21) - www.moip.msu.ru/ )

обзор! astro-ph/0207130 . ... Author: Bertil Dorch . Comments: Invited review, IAU coll. ... В обзоре рассматривается трехмерное моделирование магнитных трубок на Солнце. ... Comments: 55 pages, 35 figures -- low resolution figures to allow upload to astro-ph High-resolution version at http://www-sgk.harvard.edu:1080/~sylvain/preprints/ . ... Comments: 6 pages, 4 figures, Astron Nachr (accepted; proceedings of "1st Potsdam Thinkshop on Sunspots and Starspots", Potsdam, Germany, May 2002) . ...

Еще в разделе: (Показать все результаты (>460) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/1203.html
• http://xray.sai.msu.ru/~polar/sci_rev/0304.html
• Новости науки

... Peer review | ... VIII International Conference 'Sorokin's reading'. Social inequality as a global problem of modernity' . Dobren'kov V.I. Foreword . ... Social inequality in modern Russia . Dobren'kov V.I., Dobren'kova E.V., Averin Y.P. Inequality of the Russian population in terms of quality of life and social preference order . ... Korkiya He.D. Social inequality in modern Russia: the cultural foundations . ... Kanevskiy P.S. International organizations in global social inequality . ...

Еще в разделе: (Показать все результаты (>61) - www.socio.msu.ru/ )

• English version - Социологический факультет МГУ