... research . ... I'm a postdoc in the group of Mathematical Modelling , Institute for Chemistry and Biology of the Marine Environment (ICBM), . University of Oldenburg, 26129 Oldenburg, Germany . ... a.ryabov@icbm.de . ... Research Associate . ... Nonlinear Dynamics Group . ... Nonlinear Dynamics & Chaos Group . Moscow State University . ... Ph.D. in Nonlinear Dynamics, Moscow State University . ... Diploma work in Statistical Physics, Moscow State University . ... б©2009 Ryabov Alexey | ...

Еще в разделе: (Показать все результаты (>65) - chaos.phys.msu.ru/ )

• Alexey Ryabov. Research

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>8) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>20) - site2010.sai.msu.ru/ )

• Methods and instruments to measure/monitor major site properties

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>13) - lcl.srcc.msu.ru/ )

... RUBRRRIKA RUBRIKA Evolution of the Quantitative Measures of Quantum Information: on the Path to a Unified Theory of Quantum Information B. A. Grishanin and V. N. Zadkov Physics Faculty and International Laser Center, Moscow State University, Moscow, 119992 Russia e-mail: grishan@comsim1.phys.msu.su Received July 11, 2002 Abstract--The most general approaches to determining the quantitative measure of quantum information are analyzed based on physical content. ... with an arbitrary state | ...

Еще в разделе: (Показать все результаты (>76) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/JETP-1996-82(6)-en.pdf
• http://qilab.phys.msu.ru/papers/LasPhys-2000-10(6)-en.pdf
• http://qilab.phys.msu.ru/papers/SPIE-5128-37-46(2003).pdf

... II « » Symposium "Big History and Global Evolution" « : , , , » ( ) "Big History and Global Evolution" Scientific School for Youth "Historical globalistics: historical evolution, the present and forecast scenarios of global networks, global processes and institutions of global scale, and role of Russia and BRICS" (supported by RSCF) : .. ... 21 » International Scientific Symposium on Sustainable Development "Global Development: local conflict and challenges during 21st century : .. ...

Еще в разделе: (Показать все результаты (>84) - fgp.msu.ru/ )

Tevelev, Arc. ... Region that transsected by 'Urseis '95' includes four principal recent morphological units: (1) Pre-Uralian foredeep (subsident margin of the East European platform), (2) mountain building of the Western and Central Urals (overprinted and uplifted platform margin ); (3) East Uralian Plateau , (topographically smoothed and relatively low-level collage of oceanic, island arc and microcontinental terraines); (4) western margin of the West Siberian ...

Еще в разделе: (Показать все результаты (>22) - sbmg.geol.msu.ru/ )

• Ссылки на сейсмотомографические сайты

Aero elastic Wing Flutter LCO as a Hopf Bifurcation Point for a Nonlinear Convolution/Evolution Equation in a Hilb ert Space A. V. Balakrishnan UCLA Department of Electrical Engineering, Los Angeles CA 90095-1594, U.S.A. e-mail: bal@ee.ucla.edu Flutter is an endemic instability of all aircraft that occurs at highenough speed at any altitude. We show how it can be modelled as a Hopf bifurcation point for a nonlinear convolution/evolution equation in a Hilbert space.

Еще в разделе: (Показать все результаты (>18) - pont2008.cmc.msu.ru/ )

... Gas evolution from Brazilian rock crystal and quartz as raw materials for producing silica glass . ... Gas content, along with the content of element impurities and the content of mineral inclusions, is one of the most important characteristics of quality for quartz raw materials in producing high-quality silica glass. Gas evolution from rock crystal and vein quartz from Brazil as quartz raw materials for producing high-quality silica glass has been studied. ...

Еще в разделе: (Показать все результаты (>24) - www.kge.msu.ru/ )

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>104) - imaging.cmc.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>22) - tukachev.flogiston.ru/ )

• Category: Новости

... For those who is interested in thermodynamic modeling . Yuri Shvarov . This page is aimed mainly at the users of the software package HCh for thermodynamic (equilibrium) modeling of (geo)chemical systems and processes. However, some files presented here may also be of some interest to those who do not use HCh. ... HCh for DOS . ... User's guide for the Unitherm program intended for maintaining thermodynamic databases and calculation of thermodynamic properties of substances . ...

Еще в разделе: (Показать все результаты (>74) - www.geol.msu.ru/ )

• Department of Lithology and Marine Geology - Laboratories
• Faculty of Geology >> Geology at Moscow State University
• Faculty of Geology >> Departments

... Published by license under the OCP Science imprint, a member of the Old City Publishing Group Biologically Inspired Information Processing Technologies: Reaction-Diffusion Paradigm NICHOLAS G. RAMBIDI Physics Department, Moscow State University, Leninskie Gory, 117234 Moscow, Russia (Received February 22, 2004; In final form April 21, 2004) Chemical reaction-diffusion media represent information processing means capable to efficiently solve problems of high computational complexity. ...

Еще в разделе: (Показать все результаты (>150) - polly.phys.msu.ru/ )

• http://polly.phys.msu.ru/~rambidi/shortest%20path%20in%20a%20labirinth.PDF
• Selected publications of Rambidi, Nikolay Georgievich

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>3) - ocl.sai.msu.ru/ )

INTERNATIONAL CONFERENCE "COGNITIVE MODELING IN LINGUISTICS" CML-2011, Corfu (Greece) EXTENDED ABSTRACT SUBMISSION FORM 1. ... General Topics Cognitive Models of La nguage Phenomena For mal Models in Language a nd Cognition Cognitively-Oriented Applications a nd Resources Computer Linguistic 2. ... THE TITLE OF THE REPORT, TIMES NEW ROMAN, 12, BOLD, CENTERED 2 3 One blank line. List of authors, Times New Roman, 12, bold, centered 4 One blank line. ... One blank line. ...

Еще в разделе: (Показать все результаты (>329) - www.philol.msu.ru/ )

• International Congress of Russian Language researches - preliminary program
• LangueDOC :: Archi :: Alphabet
• MSU-LGCLL:: Curriculum Vitae of Anatoliy Anatolyevich Polikarpov

LIB-DVM library. Preliminary design . ... Lib-DVM is Run-Time System for DVM-programs execution. A parallel Fortran DVM (or C-DVM) program is translated to the program in the standard Fortran 77 (or C) language extended by Lib-DVM function calls, and to be executed according to SPMD model on the each processor program is assigned to the task. ... Input of the parameters, controlling the operating of Run-Time System, DVM debugger and the accumulation subsystem of the execution characteristics. ...

Еще в разделе: (Показать все результаты (>122) - sp.cs.msu.ru/ )

• Fortran DVM language description
• DVM-system. Installation guide. Version 3.93
• DVM-system. Installation guide. Version 3.95