div dir = ltr div div Всем спасибо. br / div Действительно - пересобрал рпм убрав quot ;numa-enabled quot ; и все заработало. br / div Теперь запрещу апдэйт торка извне и, надеюсь, заживу спокойно. br br / div div class = gmail_extra br div class = ... gt; Я несколько лет использовал самосборную torqueљ и был доволен жизнью. ... lt;<a href="mailto:david.brown@pnnl.gov" target="_blank">david.brown@pnnl.gov</a>&gt;).<br> . ... blockquote></div></div></div> . ... div> ...

Еще в разделе: (Показать все результаты (>78) - theory.sinp.msu.ru/ )

• http://theory.sinp.msu.ru/pipermail/ru-ngi/attachments/20160405/da228aae/attachment.html
• The Home of Home Pages Page

C-tutor (), . ... KPT = {UNIT_ID, KPV, DATE} . ... procedure create_test_paper (unit_id: integer; KPT: prof_table_type; n_questions: integer; delta_w: integer) { unit_id , = n, max(|e - w|) delta_w} begin { 1: , , e} KL NULL; { KL} for ( k_no dei Unitu_id ) begin find KPVi in KPT; ei KPVi в W; if ei 0,85 then { ei > 0,85 , } insert k_no dei into KL, ei ; end; { 2: , , w e, |e - w| delta_w} count 1; { } testpap er := NULL; p := KL head; while (count < n_questions) and (p = NULL) begin e , p; Qcount . ...

Еще в разделе: (Показать все результаты (>4) - www.intsys.msu.ru/ )

... Asn Pro Ser Ser Leu .. ... CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN 1 MVGSSEAGGEAWRGRYYRLEEVQKHNNSQSTWIIVHHRIYDITKFLDEHP .: ... HUMAN , MOUSE } vs { CAEEL , PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL } vs { PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI } vs { MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI , MARPO } vs { BRANA , VICFA } HUMAN + + + + MOUSE + + + + CAEEL + + + VICFA - BRANA - MARPO + ...

Еще в разделе: (Показать все результаты (>1560) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/FBB/year_08/term4/trees.pdf

Newsgroups: comp. parallel ,comp.sys.super From: eugene@sally.nas.nasa.gov (Eugene N. Miya) Reply-To: eugene@george.arc.nasa.gov (Eugene N. Miya) Subject: [l/m 3/10/98] finding ||-ism references -- comp. parallel (14/28) FAQ Organization: NASA Ames Research Center, Moffett Field, CA Date: 14 Mar 1998 14:58:07 GMT Message-ID: 6ee5tv$ed0 ... If not specialized (generalist): Fourth: consider my biblio (NASA.TM-86000). ... DISADVANTAGES: needs lots of catch up work. ... ADVANTAGES: Free. ... Ask. ...

Еще в разделе: (Показать все результаты (>44) - www.parallel.ru/ )

• MPI: Message Passing Interface - русскоязычная страница | PARALLEL.RU -

... Copyrightї1997 Bob Yen (byen@ix.netcom.com) (http://www.comet-track.com/hb/hb.html) . ... Information on Comet Hale-Bopp for the Non-Astronomer Hale-Bopp rotates about twice a day (3/14/97) . ... The Comet Observation Home Page was been selected to receive the Griffith Observatory Star Award for the week of February 2 - 8, 1997 for excellence in promoting astronomy to the public through the World Wide Web. ... Typically, about 1,000 individual users/computers access this page every day. ...

Еще в разделе: (Показать все результаты (>3) - www.issp.ac.ru/ )

• Comet Ephemerides

Correlations of substitutions predict specific protein- DNA contacts in the MerR family of transcriptional factors Ilya Zharov, Kharkevich Institute for Information Transmission Problems, Russian Academy of Sciences ... University, Moscow, Russia, 119991 , lan787@yko.name Correlations of substitutions between the sequences of transcriptional factors ( TFs ) and their binding sites may be used to predict specific contacts between the protein and DNA residues ...

Еще в разделе: (Показать все результаты (>11) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/MCCMB13_Program_2307e.pdf

С 24 июня по 7 июля состоялась стажировка студентов программы 'Бакалавр' Высшей школы бизнеса в Северо-восточном университете г. Бостон. Темой стажировки стала High Technology Business Course . ... Как сказала одна из участниц стажировки, Ольга Шатило: Это неоценимый опыт. ... Также, в рамках стажировки была предусмотрена обширная культурная программа: экскурсии, посещение музеев и прогулки по городу. ...

Еще в разделе: (Показать все результаты (>27) - www.mgubs.ru/ )

• Неримские не-каникулы
• Американский бизнес на практике: неделя EMBA в Бостоне

... Anti thrombin DNA aptamers were immobilized on silica microspheres, placed inside microwells on the distal tip on an imaging optical fiber, coupled to a modified epifluorescence microscope through its proximal tip. ... It should be mentioned that since thrombin is not a DNA binding protein, the possibility to elicit thrombin­aptamer complexes clearly demonstrates the power of SELEX technology. ... Specificity of aptamer coated beads for F thrombin binding was assessed with bovine serum albumin. ...

Еще в разделе: (Показать все результаты (>2) - rnp-group.genebee.msu.ru/ )

... Темы докладов. 1998-1999 учебный год . ... Дата доклада: 19 апреля . ... Представление и использование знаний. ... Представление знаний правилами .. М. "Мир". 1989г. Докладчик: Борисов П. 2. ... Приобретение знаний - М. "Мир". 1990г. Докладчик: Марков С. 4. ... Введение, классификация сетей, простейшие алгоритмы обучения.) [общий доклад] Дата доклада: 15 марта . ... М. "Мир" 1989г. Докладчик: Блохин А. Курсовые работы. 3 курс . ... Исполнитель: Марков С. Курсовые работы 4 курс . ...

Еще в разделе: (Показать все результаты (>6) - sp.cs.msu.ru/ )

... 2009; 23: 1241­1248 Published online in Wiley InterScience (www.interscience.wiley.com) DOI: 10.1002/rcm.3994 Mass spectrometric study of peptides secreted by the skin glands of the brown frog Rana arvalis from the Moscow region T. Yu. ... The present work aims at establishing the primary structure of the peptides constituting the secretion of the skin glands of the common brown frog Rana arvalis from the Moscow region in Russia by means of mass spectrometry. ... Peptides 2004; 25: 1035. ...

Еще в разделе: (Показать все результаты (>8) - vertebrata.bio.msu.ru/ )

• Sergei V. Ogurtsov
• Концепции экологии: история и современность

XXI ) : 23.00.02 - , - 2015 « ». ... 1992. ­ 3. ­ . ... 2000; . ... 5; Beck U. World Risk Society. ... Cambridge, 1990; Luhmann N. Risk: A Sociological Theory. ... Modern Political Analysis. ... Risk Management and construction. ... New York: McGraw-Hill, 2000; Charles R. Kennedy (1988), "Political Risk Management: A Portfolio Planning Model," Business Horizons, 31(6); Carlson, Sunne. ... Published by Routledge, 2009. ­ 304 p.; Brink, Charlotte H. Measuring political risk: risks to foreign investment. ...

Еще в разделе: (Показать все результаты (>6) - www.spa.msu.ru/ )

• http://www.spa.msu.ru/uploads/files/h8dissertazionnii_sovet_d_501.001.27h8brh923.00.02__polititcheskie_instituti_prozessi_i_tehnologiih9/vasilieva_dissertaciya.pdf
• http://www.spa.msu.ru/uploads/files/books/brand_man.pdf

International Journal for Parasitology 32 (2002) 817-824 www.parasitology-online.com Host manipulation by Ligula intestinalis: a cause or consequence of parasite aggregation? ... Here we consider whether these behavioural changes are important in shaping the distribution of parasite individuals across the fish population. ... Keywords: Ligula intestinalis; Roach; Macroparasitic aggregation; Host manipulation 1. ... Inference of parasite-induced host mortality from distributions of parasite loads. ...

Еще в разделе: (Показать все результаты (>13) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/4_UCHEB/Kontseptsii_ekologii_program.doc
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf
• Персональные страницы

... Главная Факультет политологии Новости факультета Новость . ... 9 сентября 2013 года на факультете политологии состоялась лекция профессора Джорджтаунского Университета (США) Чарльза Кинга (Charles King) . ... Заместитель декана по международным связям доцент А. Л. Демчук поблагодарил Ч.Кинга за увлекательную, насыщенную информацией лекцию и подарил ему книги ученых факультета политологии МГУ, посвященные проблемам безопасности и международных отношений. ... Перевод на факультет . ... Факультет . ...

Еще в разделе: (Показать все результаты (>8) - polit.msu.ru/ )

Fo cal Stability Charles Pugh Department of Mathematics, University of Toronto, Toronto, Canada e-mail: cpugh@math.utoronto.ca Generically, how many geodesic loops of the same length originate at a common point? ... Abraham's Bumpy Metric Theorem and its proof by Anosov play a role, as does our focal stability conjecture. This last is a kind of structural stability conjecture for the focal decomposition of the generic exponential map. ... In some cases we have verified the conjecture. ...

Еще в разделе: (Показать все результаты (>3) - pont2008.cmc.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>20) - www.chemport.ru/ )

• весы прецизионные Adventurer (Ohaus)
• Результат поиска по фразе "весы прецизионные Adventurer (Ohaus)"
• ЛЕКТИНЫ

... кафедра ПЕТРОЛОГИИ . ... 2012 . ... Mints, M.V., Dokukina K.A., Konilov A.N., The Meso-Neoarchaean Belomorian eclogite province: Tectonic position and geodynamic evolution, Gondwana Research (2012), http://dx.doi.org/10.1016/j.gr.2012.11.010 . ... Gerya T. (2012) Origin and models of oceanic transform faults. ... Маракушев А.А., Глазовская Л.И., Панеях Н.А., Маракушев С.А. (2012) Генезис крупнейшего в мире уран-золотого месторождения Витватерсранд (Ю.Африка) Пространство и Время, том 2, ? ...

Еще в разделе: (Показать все результаты (>8) - www.geol.msu.ru/ )

... Географии мирового хозяйства . ... Выберите кафедру . ... Кафедры . ... География" . ... Dyakonov K.N., Bochkarev Yu.N. Geophysical factors influencing the diameter increment of trees in the landscapes of the West-Siberian Plain and the Elbrus region . ... Tarasova L.L., Shulgin I.A. Hydro-radiation regime and potential yields of early spring crops in the Central-Chernozem oblasts and the Middle Volga River region . ... Korotayev V.N. Topography and the history of evolution of the Kolyma River delta...

Еще в разделе: (Показать все результаты (>29) - www.geogr.msu.ru/ )

• Авторский указатель. Общий список источников.

... variИtИ du franГais», «accent». ... Indiquez sur la carte les pays francophones. ... Le franГais en Belgique: - gИographie-histoire-politique-Иconomie du pays; - situation historique; diversitИ des accents; belgitude; insИcuritИ linguistique, politique linguistique. Hommes de lettres. ... Le franГais en Afrique centrale et des Grands Lacs: - gИographie-histoire-politique-Иconomie des pays; - implantation historique du franГais dans les colonies, situation contemporaine du franГais, nИgritude. ...

Еще в разделе: (Показать все результаты (>37) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/students/courses/fl-teaching/2-basova-general-english-2-lmkk-year.pdf

1877 л Ё 1826, Daniel Colladon, Charles Sturm, , 1687, 1490, : л... , , ...Ё r r p r v r r r r + g + v + (v, )v = - t r + div ( v ) = 0 t r v r r + + div v 3 r r v p r + g =- t / r + div v = 0 : rrr r r t v = v 0 + v v 0 = 0 v - r p = p 0 + p p p p 0 0 r =g 0 0 = 0 + r v t r v t r r p 0 p r =- - +g t 0 0 =- r p r +g r v =- r (p 0 + p) 0 + r +g r -g r v t =- r p 0 t (0 + ) t t r + div v = 0 r + div (0 + ) v = 0 r r + div (0 v + v) = 0 t r + 0 ...

80. Young Nobel Prizers in Physics