Trudy GAISH, vol. LXV, 1996 . Abstracts . The global distribution of average (5 O x 5 O ) depths . of Mohorovicic discontinuity on the Earth . ... Such analysis allows detecting whether the sources of the largest anomalies reside within the Earth's core. This is possible if the limit depths of the sources exceed the depths of the core-mantle boundary. ... by Pasinok S.L. Influence of the Earth’s cover on the polar free oscillation of the Earth’s inner core is considered. ...

Еще в разделе: (Показать все результаты (>237) - lnfm1.sai.msu.ru/ )

• HSFA 2 technical description Technical Details
• Sputnik and SETI: Uniting East and West

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>656) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~maravilla/term2/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta

... The intensity of neutral beams generated from various shapes of nozzles was measured and the orifice diameter of skimmer was adjusted. ... The ratio of monomer ion in the beam was 58%. ... Results and discussion Fig. 2 shows the skimmer diameter dependence of neutral beam intensity from the metal nozzles B and C. The source gas was Ar. ... Conclusion In order to get high intensity of neutral cluster beam, new metal nozzles were constructed and orifice diameter of skimmer was adjusted to beam...

Еще в разделе: (Показать все результаты (>119) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_902_Yamada_largeClasterIonCurrent.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_GCIB_Ar_Smoothing_Swenson.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_GCIB_processing_Swenson.pdf

... Our Partners . ... URALCHEM Holding P.L.C., a company incorporated in Cyprus and the holding company for URALCHEM Group, one of the largest producers of nitrogen and phosphate fertilizers in Russia and the CIS. ... Thermodynamics center of precise calorymetry investigations.љ ... Facility for the Analysis of Chemical Thermodynamics ( Decterov S.A. љ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>10) - td.chem.msu.ru/ )

• Carbamide Laboratory of Chemical Thermodynamics

русский english MSU of Lomonosov Higher School . of Policy in Culture . and Administration in Humanities (faculty) . ... Magistracy . ... Management in Culture . Management in Sport . ... Faculty in the people . ... academic adviser of the Higher School of Policy in Culture and Administration in Humanities (faculty) in Lomonosov Moscow State University. ... Higher School of Policy in Culture and Administration in Humanities (faculty Lomonosov Moscow State University) 2016 . ...

Еще в разделе: (Показать все результаты (>27) - hsscm.msu.ru/ )

• Higher School of Policy in Culture and Administration in Humanities (faculty
• Lecturers - Higher School of Policy in Culture and Administration in Humanities
• Art business - Higher School of Policy in Culture and Administration in

Mustela sibirica . Spatial variation of sexual dimorphism in the Siberian weasel Mustela sibirica (Mustelidae, Carnivora) . ... Spatial variation in sexual size dimorphism was assessed for the Siberian weasel ( Mustela sibirica ) across localities in Western, Central and Eastern Siberia. ... Adaptive significance of sexual dimorphism in weasel // Oikos. ... Sexual dimorphism and geographical variation in the body size of the yellow weasel (Mustela sibirica) // Acta Theriologica Sinica. ...

Еще в разделе: (Показать все результаты (>1517) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• Mammalia
• XIV International Ornithological Conference of North Eurasia: Excursions

... 21 Дек 2015 . кем editor | ... 16 Мар 2015 . ... Родилась 31.01 1932 г. 2 Мар 2015 . ... 5 Май 2015 . ... Декабрь 2015 . Ноябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>128) - elana.sinp.msu.ru/ )

• Your car really need to be free of rust spots over the long-term to prevent

Клуб выпускников МГУ (Московский Государственный Университет) . Российский фонд фундаментальных исследований, в рамках Соглашения с Нидерландской организацией по научным исследованиям (NWO), объявляет конкурс 2005 года совместных исследовательских проектов групп голландских и российских ученых по следующим областям знаний: . ... Humanities research helps to strengthen the validity and innovative scope of the ICT field. ... It provides advanced and for Russian researchers attractive facilities. ...

Еще в разделе: (Показать все результаты (>870) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: МГУ попал в репутационный рейтинг Higher Education World
• Клуб выпускников МГУ: The Blood Test Gets a Makeover

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... Prospective students . ... http://www.audit.msu.ru . ... The School of State Audit was founded in 2006. The main objective of the School of State Audit is to train highly-qualified professionals who combine profound knowledge of law and economics with professional competence in making and implementing management decisions. ... Students at the School of State Audit are to pay tuition fees. ...

Еще в разделе: (Показать все результаты (>146) - www.msu.ru/ )

• HIGHER SCHOOL OF MODERN SOCIAL SCIENCES
• Lomonosov Moscow State University
• Victor T. Trofimov. Vice-Rector

... Optical Tamm state at the cholesteric liquid crystal/metal interface Gulkin D.N., Bessonov V.O., Sob oleva I.V., Fedyanin A.A. Faculty of Physics, Lomonosov Moscow State University, Moscow, 119991, Russia e-mail: bessonov@nanolab.phys.msu.ru Optical Tamm state (OTS) is an optical analogue of Tamm state which is electronic density lo calization at the b oundary of p erio dic atomic p otential. ... Fig. 1c demonstrates that the OTS excitation o ccurs over a large range of angles of incidence. ...

Еще в разделе: (Показать все результаты (>57) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/dd15_shilkin.pdf

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>339) - www.geogr.msu.ru/ )

• wcufi
• High Point tech High Point tech (все сообщения)
• CONTENTS ? 3 - 2014

... For HP-UX 9.X: Upgrade to 10.20 . For HP-UX 10.[ 00|01|10]: Upgrade to 10.20 . ... This will allow you to configure the size of the TCP connection lookup hash table. ... If folks are running Apache on a PA-8000 based system, they should consider "chatr'ing" the Apache executable to have a large page size. ... The change can be validated by running Glance and examining the memory regions of the server(s) to make sure that they show a non-trivial fraction of the text segment being locked. ...

Еще в разделе: (Показать все результаты (>62) - neptun.sai.msu.ru/ )

• Performance Tuning Tips for Digital Unix
• Running a High-Performance Web Server for BSD
• Apache Server Virtual Host Support

trendence Graduate Barometer Europe 2011 About the survey ­ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )

... Useful Information . ... Vestnik CIE (in Russian) . ... Information about Russia . ... With an area of 17,075,200 square kilometres, it is the largest country in the world by land mass, covering almost twice the territory of the next-largest country, Canada. ... Formerly the dominant republic of the Union of Soviet Socialist Republics (USSR), Russia is now an independent country and an influential member of the Commonwealth of Independent States, since the Union s dissolution in December 1991. ...

Еще в разделе: (Показать все результаты (>44) - www.cie.ru/ )

... О кафедре . ... О профессорах кафедры . ... Программы общих курсов . ... Квантовая теория . ... Курсовые работы для 2-го курса . ... Новости . ... Новости кафедры . ... В разделе Квантовая теория выложены список всех тем курса и вопросы к экзамену. ... Приказом Ректора МГУ профессор Виктор Иванович Денисов с 02.11.2015 г. назначен заведующим кафедрой квантовой теории и физики высоких энергий физического факультета МГУ. ... С 8 апреля пройдет тестирование студентов 3-го курса по квантовой теории. ...

Еще в разделе: (Показать все результаты (>8) - hep.phys.msu.ru/ )

... Signatories: file:///C|/Dokumente%20und%20Einstellungen/MCS/E...s/ Bologna /Rohdaten/dok/ Bologna %20declaration.htm (4 of 6) [12.02.2002 17:14:17] THE EUROPEAN HIGHER EDUCATION AREA Caspar EINEM Minister of Science and Transport (Austria) Jan ADE Director General Ministry of the Flemish Community Department of Education (Belgium) Eduard ZEMAN Minister of Education , Youth and Sport (Czech Republic) Tonis LUKAS Minister of ...

Еще в разделе: (Показать все результаты (>30) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/documents/umo/bologne/Sorbonne%20Joint%20Declaration.%20Joint%20declaration%20on%20harmonisati.pdf
• http://www.socio.msu.ru/documents/umo/bologne/THEEUR~1.PDF

Projects . ... SmpB . During trans- translation, stalled bacterial ribosomes are rescued by small protein B ( SmpB ) and by transfer-messenger RNA (tmRNA). ... We present evidences that SmpB binds the large and small ribosomal subunits in vivo and in vitro . ... SmpB contacts the large subunit transiently and early during the trans -translational process. The affinity of SmpB for the two ribosomal subunits is modulated by tmRNA in the course of trans -translation. ...

Еще в разделе: (Показать все результаты (>32667) - dualopt1.cmm.msu.ru/ )

• SmpB - Projects - TWiki - (printable)
• %TOPICTITLE% ( vs. 1) - TWiki
• TWikiTip009 - TWiki - TWiki

... Introduction: In the present work the morphometric parameters for 87 large martian craters [1](with diameters from 411 up to 110 kms) have been determined: depth of a crater, the relation of depth of a crater to diameter (/D), height of a rim ­ h, with the help of profiles constructed on the basis of supervision of space vehicle MGS [2].The comparison with similar morphometric parameters of large lunar craters also is fulfiled. ... 2000) Morphological Calague Of the Craters Of Mars. ...

Еще в разделе: (Показать все результаты (>104) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Greg/Publications/ms42/m42_50.pdf
• http://selena.sai.msu.ru/Chik/Publications/ms42/m42_12.pdf
• http://selena.sai.msu.ru/Symposium/ant.pdf

... The Northeastern margin of the Qinghai-Xizang (QingZang) Plateau links the western Loess Plateau and the inland arid area of China, where there are a large dust input rate and the thickets loess in the world. ... These two advantageous conditions from the unique high-resolution loess climatic record and the most complete paleosol sequence since the last interglacial in the world. ... Back to the Abstracts list ...

Еще в разделе: (Показать все результаты (>175) - www.fadr.msu.ru/ )

• THE POST-SIMPOSIUM EXCURSION (July 31 - August 7,1998)
• Фотоархив "EcoPhoto" - Публикации

Humic substances as active anti-HIV components for microbicides G.V. Kornilaeva1, I.V. Perminova2, E.V. Karamov1 Ivanovskiy Institute of Virology, 16 Gamaleya st., 123098 Moscow, Russia Department of Chemistry, Lomonosov Moscow State University, Leninskie Gory 1-3, 119991 Moscow, Russia 2 1 Background: At present there is a large data set on ability of humic substances to induce non-specific immune response in living organisms. ... W hile their anti-HIV activities were high enough. ...

Еще в разделе: (Показать все результаты (>146) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2008/2008-sorkina-synthesis.pdf
• http://www.mgumus.chem.msu.ru/publication/2005/kholodov-enchanced-2005.pdf