AN ORIGIN FOR THE SOUTH POLE-AITKEN BASIN THORIUM. ... Moscow University. ... Introduction: The lunar South Pole-Aitken (SPA) impact basin is one of the largest and oldest impact basins and has thus been heavily degraded by postbasin-formation primary impacts and their ejecta [1]. ... The SPA basin thorium map: The using data Lunar Prospector [4] the thorium distribution map demonstrated a hemisphere of the Moon which contains the SPA basin structure and its environs was constructed. ...

Еще в разделе: (Показать все результаты (>89) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Rod/Publications/ms40/21_Dolitsky_etal.pdf
• http://selena.sai.msu.ru/Bus/Publications/UFN2007(Bus_etal)(engl).PDF
• Бережной А.А.

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>163) - www.pereplet.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

Intel® Fortran Compiler Options Quick Reference Guide for Linux* Systems Legal Information Copyright © 2003 Intel Corporation Document Number: 253258-001 i Intel® Fortran Compiler Options Quick Reference Disclaimer and Legal Information Information in this document is provided in connection with Intel products. No license, express or implied, by estoppel or otherwise, to any intellectual property rights is granted by this document. EXCEPT AS PROVIDED IN INTEL'S TERMS AND CONDITIONS OF SALE FOR SUCH

Еще в разделе: (Показать все результаты (>50) - www.arcetri.astro.it/ )

... Development of a Database on Experimental Crystal-Melt Equilibria for Igneous Rocks: INFOREX System, Version 3.0 S. S. Meshalkin*, A. A. Ariskin*, G. S. Barmina*, G. S. Nikolaev*, and R. R. Al'meev** * Vernadskii Institute of Geochemistry and Analytical Chemistry, Russian Academy of Sciences, ul. ... Main options of the INFOREX-3.0 database-management system and the scheme of exchange between the system and data files. problems that require experimental data on phase equilibria. ...

Еще в разделе: (Показать все результаты (>424) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Rubanova.htm
• http://geo.web.ru/users/pavel/Publications/2004/EHou05z.doc
• http://geo.web.ru/users/pavel/Publications/2004/EHou05z.pdf

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... The correct theoretical analysis of the generally accepted foundations of theoretical physics is proposed. ... The main result is as follows: the foundations (i.e. classical thermodynamics, the special theory of relativity, quantum mechanics) contain logical errors The existence of logical errors is irrefutable proof of incorrectness of the theoretical foundations and means that theoretical physics enters the greatest crisis. ...

Еще в разделе: (Показать все результаты (>283) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: AGEING Dr.Sula - General Overview 2008

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... xslt2] error внутри variable . ... Re: [xslt2] error внутри variable [ re: Tarass ] . ... Re: [xslt2] error внутри variable [ re: vond ] . ... XSLT2 - 2.9 Error Handling : . ...

Еще в разделе: (Показать все результаты (>3948) - www.snto-msu.net/ )

• Проблемы с MSDN, что c VS2005 Feb CTP - Public forum of MSU united student
• [News] Научное программное обеспечение - Public forum of MSU united student
• Как запустить экзэшник визуалка 2005 под винду - Public forum of MSU united

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... xslt2] error внутри variable . ... Re: [xslt2] error внутри variable [ re: Tarass ] . ... Re: [xslt2] error внутри variable [ re: vond ] . ... XSLT2 - 2.9 Error Handling : . ...

Еще в разделе: (Показать все результаты (>5917) - www.fds-net.ru/ )

• головоломка - Public forum of MSU united student networks
• Где в интернете можно обсудить dynamic sql automatic checking? - Public forum
• [News] Научное программное обеспечение - Public forum of MSU united student

Mitigating Activity of Humic Substances and their Si-enriched Derivatives in relation to Wheat Seedlings under Salt-Stress Condition Olga I. Philippova1, Natalia A. Kulikova1, Leonid A. Karpiouk2, Galina F.Lebedeva1, Irina V. Perminova 1 2 Department of Soil Science, Lomonosov Moscow State University, 119992, Moscow, Russia, Department of Chemistry, Lomonosov Moscow State University, 119992, Moscow, Russia philippova@soil.msu.ru 2 Keywords: humic, bioactivity, silicium, stress 1. ...

Еще в разделе: (Показать все результаты (>138) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2009/2009-sorkina-study.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-kulikova-detoxifying.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-klein-coal.pdf

Problems for Ultrahyperbolic Equations in Half-Space Prof. Dmitry P. Kostomarov Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Pontryagin Anniversary Conference June 17­22, 2008 , Moscow, Russia Section Differential Equations Subsection Partial Differential Equations Prof. D.P. Kostomarov (CMC MSU) Problems for Ultrahyperbolic Equations June 22, ... June 22, 2008 (2.13) Problems for Ultrahyperbolic Equations 16 / 23 2.2. ...

Еще в разделе: (Показать все результаты (>9) - ani.cmc.msu.ru/ )

FIRST SCREEN . Input files : image with wedges and image with spectrum (fits or tiff format). ... What to do : First of all you must fill in the region which the profiles should be taken from, by pressing "range for profiles" button. ... SECOND SCREEN . ... THIRD SCREEN . ... In the first screen you can change the size of the image by pressing "CHANGE SIZE" button. ... After pressing "Next profile" button, click to the same spectral lines in the same order as you did in the first profile. ...

Еще в разделе: (Показать все результаты (>164) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Structure
• Manpage of FITSHDR
• Data bases of Natural Satellites. Documentation. Sources

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

... О Школе . ... Магистерская программа Высшей школы бизнеса МГУ получила международную аккредитацию ABEST21 . ... В 2015 году Высшая школа бизнеса МГУ подтвердила статус одной из ста лучших бизнес-школ мира и получила награду высшей категории как 'бизнес-школа, имеющая наивысшее международное влияние'. 21.10.2015 . ... Декан Высшей школы бизнеса МГУ О.С. Виханский получил награду от Международной ассоциации бизнес-образования ABEST21 за 10-летний вклад в работу ассоциации в качестве ее Вице-президента...

Еще в разделе: (Показать все результаты (>4428) - www.mgubs.ru/ )

• Высшая школа бизнеса МГУ им. Ломоносова
• МАГИСТРАТУРА ВЫСШЕЙ ШКОЛЫ БИЗНЕСА МГУ | Высшая школа бизнеса МГУ им. Ломоносова
• ПРОГРАММА MBA модульный формат | Высшая школа бизнеса МГУ им. Ломоносова

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/PhysCon2005.pdf

... Meeting at the Russian Union of Rectors International Conference on the Arctic WWF calls to protect the Arctic The President signs law on radioactive waste The problems of Lake Baikal Cleaning of Russia 's Arctic zone Moscow is expanding Moscow goes for selective waste collection Protected areas on land being connected to Moscow Discussion of Moscow 's program for Environmental Protection New protected ... Source: Russian Prime Minister V. Putin's site. ...

Еще в разделе: (Показать все результаты (>232) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/1_11.pdf
• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/6_11.pdf
• http://www.geogr.msu.ru/structure/labs/notl/nauchd/downloads/2015_Bolshakov.Kuzmin_QuatSciRev_full-text.pdf

Psychology in Russia: State of the Art · 2009 On scientific status and prac tic al signific ance Of One psychOlOgyc al theOry Andrei I. Podolskij Lomonosov Moscow State University Moscow Since the late 1950s, a significant number of authors tried to use Galperin's approach (which is well-known as the "Theory of planned stage-by-stage formation of mental actions", or the PSFMA Theory) to improve schooling processes and results. ... The new mental action begins its own "psychological life". ...

Еще в разделе: (Показать все результаты (>145) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/poddiakov.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/nazarov.pdf
• http://www.psy.msu.ru/science/psyrussia/2013/dunas.pdf

Variety of Long-Eared Owls (Asio otus L.) Diet as Index of Habitats Usefulness. ... Owls draw to themselves attention, due to a number of such features, as a wide circulation practically in all natural zones, an originality of ecology, behavior and morpho-physiology; prospect synantropisation some species on a background of disturbing decrease in number of others, difficultly observable and, still, poorly studied. ... Adult owl brings young sparrow from birddealer to his fledgling. ...

Еще в разделе: (Показать все результаты (>42) - vertebrata.bio.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

О лаборатории . ... Лаборатория теоретической биофизики . ... Download script: memgen-0.0.1.tar.gz System requirements: python 2 (2.6 and higher), python openbabel library, python numpy library. ... continue reading..... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . OPLS-AA patch for different types of molecules . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>51) - erg.biophys.msu.ru/ )

• gromacs ERG Research Group: Лаборатория теоретической биофизики
• Constructing discrete Laplacian via sparse matrix ERG Research Group:
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики

Russian-American Academic Exchanges Alumni Association . Statement of Purpose . ... It enables us to feel a part of a larger body of scholars engaged in international academic exchange and in educational reforms and civil society building in this country. ... To support and promote the idea of US/Russian academic exchange . ... To assist American participants of US/Russian academic exchanges by facilitating their contacts with the colleagues in various Moscow and regional institutions. ...

Еще в разделе: (Показать все результаты (>112) - www.prof.msu.ru/ )

• HUMAN RIGHTS AND DEVELOPMENT
• Conflict Transformation, Ngo And Networking