... Credit: ISS Expedition 22 Crew , Shuttle Endeavour STS-130 Crew , NASA Explanation: This space job was almost complete. Floating just below the International Space Station , astronaut Nicholas Patrick put some finishing touches on the newly installed cupola space windows last week. ... NASA Official: Jay Norris. ... Publications with keywords: international space station - ISS . Publications with words: international space station - ISS . ... Sunset from the International Space Station . ...

Еще в разделе: (Показать все результаты (>4210) - www.astronet.ru/ )

• Астронет > Columbus Laboratory Installed on Space Station
• Columbus Laboratory Installed on Space Station
• Астронет > Astronaut Installs Panoramic Space Window

... About lab . ... GML Matting is now part of the GrowCut project. ... GML Matting is merged into GrowCut . ... Partial support for 16-bit and 32-bit images (matting algorithm is still 8-bit and downgrades the color-depth in fuzzy areas, but opaque areas retain their original color) . ... Fixed failure in older versions of Paint Shop Pro (namely 7.0) . ... For Paint Shop Pro users it can become the essential matting plugin since Paint Shop Pro has no built-in matte extraction functionality. ...

Еще в разделе: (Показать все результаты (>170) - graphics.cs.msu.ru/ )

• GML Matting | Лаборатория компьютерной графики и мультимедиа
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>42) - angel.cs.msu.su/ )

• : Interface NetcdfService
• Index of /~oxana
• Index of /~oxana/image_processing

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>6) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>24) - tukachev.flogiston.ru/ )

• Coursera?s Computing for Data Analysis course on R
• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>49) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Figure 3.2: Slide Show Parameters . All the files in the current directory may be seen one by one in automatic regime using command File/ Slide Show . ... In the center field of the Slide Show parameters dialog is a table, witch shows all associable files in chosen directory. User can remove files from the table (and from the future slide show) by pressing Delete button or by choosing Delete Selection command from the menu that appears after clicking mouse right button. ...

Еще в разделе: (Показать все результаты (>38) - www.spm.genebee.msu.ru/ )

• Message window
• Server
• Files Saving and Export

An electronic file with the submitted manuscript should be of the following form. %---------------------------- \def\udk{UDC} \ltitle{Title of the manuscript (in CAPITAL LETTERS)} {Author initials and name(s)} \oabstract{ Abstract of the manuscript } Text of the manuscript \end{document} %-------------------------- . ... Sectioning of a manuscript without the use of standard commands can be done as follows: %------------------------------------------------ \par {\bf Title of the section.} ...

Еще в разделе: (Показать все результаты (>56) - vestnik.math.msu.su/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рейтинг: 43 . New CPU installed . ... Рейтинг: 9289 . Re: New CPU installed [ re: rosablanca ] . ... Re: New CPU installed [ re: Panzer ] . ... Рейтинг: 5344 . ...

Еще в разделе: (Показать все результаты (>630) - www.snto-msu.net/ )

• злое%;?"чий php.как в нем дебаггер поставить? - Public forum of MSU united
• The Windows product key installed on this computer is not genuine - Public
• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU

Lomonosov Moscow State University . ... Academic Programs . Academic Board . International Cooperation . ... Academic Departments Programs . ... Bulletin of Moscow University . ... Contact Us . Phone Email Directory . ... Phone: (495) 734 03 22 . Fax: (495) 932 88 67 . ... Phone: (495) 932 99 15 . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>86) - ffl.msu.ru/ )

... ЭОС истфака МГУ . ... x25BA; Кафедра исторической информатики . ... Course categories: Кафедра истории средних веков Кафедра исторической информатики Кафедра исторической информатики / Практика использования ДОТ Кафедра истории России до начала XIX века Кафедра новой и новейшей истории стран Европы и Америки Кафедры этнологии Археографическая лаборатория Школа учителей истории . ... Информационные технологии и математические методы в исторических исследованиях и образовании . ... Home ...

Еще в разделе: (Показать все результаты (>4364) - www.hist.msu.ru/ )

• ЭОС истфака МГУ: Course categories
• Электронная образовательная среда исторического факультета МГУ имени
• Summary of История Древнего Мира

... Brown x26; Mussett The Inaccessible Earth 01 Introduction.pdf . ... Brown x26; Mussett The Inaccessible Earth 02 Chapter.pdf . ...

Еще в разделе: (Показать все результаты (>50) - ocean.phys.msu.ru/ )

• Index of /courses/geo/lectures-addons/
• Index of /courses/geo/lectures-addons-11/
• Index of /courses/geo/lectures-addons/02/

... If this bit of homework finds be also mind-boggling, contemplating working through on line wholesale directory like Salehoo to support in your lookup. ... celine outlet italia , because these brands are high quality and put on weight no need to re-emphasize that unless they?re selling high resolution replica bags or issue. burberry bag charm in along with large wholesale fashion designer bags. ... 2016 С Днем Победы! ...

Еще в разделе: (Показать все результаты (>44) - elana.sinp.msu.ru/ )

• editor | С Днем Победы!

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide

ERROR: You need to create the directory /home/www/hist/vledata with web server write access . ... В настоящее время материалы дистанционной поддержки к курсам, читающимся на историческом факультете МГУ им. М.В.Ломоносова, вы можете найти по адресу: vle.hist.msu.ru Skip Calendar . ...

Еще в разделе: (Показать все результаты (>37462) - hist.msu.ru/ )

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . asm / . 2016-Feb-21 14:32:38 . - . Directory . atmos / . 2015-Dec-21 19:17:42 . - . Directory . avrup / . 2010-Apr-24 21:34:09 . - . Directory . mirror / . 2009-Dec-06 17:57:48 . - . Directory . rs485 / . 2015-Feb-03 20:07:40 . - . Directory . sv / . 2009-Nov-26 18:26:21 . - . Directory . turbina / . 2009-Nov-26 18:14:43 . - . Directory . lighttpd/1.4.37

Еще в разделе: (Показать все результаты (>32) - curl.sai.msu.ru/ )

• Index of /pub/mirror/
• Index of /pub/mirror/suse/
• Index of /pub/atmos/

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

58. SDP home page

59. Nhunt: program for nucleic acid sequence similarity search

60. http://observ.pereplet.ru/images/evgeny/stev/m_download.php