... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>6594) - wiki.cmc.msu.ru/ )

• WebCreateNewTopicComponents < System < Foswiki
• JQueryGradient < System < Foswiki

Three-component velocity field reconstruction algorithms in Stereo PIV" . Markovich D.M., Tokarev M.P. The paper presents some principles of Stereo PIV measurements of instantaneous velocity fields in liquid and gas flows. The problem of camera calibration for an optical stereo system in relation to the optical methods for velocity measurements is described. ... Two methods for the stereo reconstruction of velocity fields are described. ... PostScript (in Russian) (5.04MB) . ...

Еще в разделе: (Показать все результаты (>190) - num-meth.srcc.msu.ru/ )

• "An iterative method for computing the flows of a viscoplastic Bingham medium"
• "Implementation of an object-oriented model of domain decomposition on the
• "A method of iterative regularization for solving inverse problems of forming

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... Reactivity thermoelectric clathrate compounds in interaction with components of the air . The project aims to address the fundamental problems of solid state chemistry - revealing the fundamental regularities of the reactivity of crystalline phases in reactions with air components and processes of formation of oxide layers (coatings) for new materials. ...

Еще в разделе: (Показать все результаты (>11) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials |

... They in fact form surfaces that can be treated as interfaces between polar aqueous solutions and non-polar environment of phospholipidic side chains. ... That's why our idea was to study the behaviour of amino acid residues, as monomer units of proteins, in an interfacial system. Objective By means of molecular dynamics simulations we intended to study the properties of amino acid residues in a system containing liquid-liquid interface between water and hexane, which we took as a non-polar phase. ...

Еще в разделе: (Показать все результаты (>139) - polly.phys.msu.ru/ )

• Научный семинар 21.01.2013
• Научный семинар

Multicomponent Models of Friction / Sentemova O.S. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>121) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 1/2012

... Initial mass function and binary stars . ... The principal goal of this study is to show that the real shape of the initial mass function for low- and intermediate-mass stars differs from the observed one. In particular, comparison of radii of eclipsing binary components and single stars shows a noticeable difference for B0V-G0V components of eclipsing binaries and single stars of the corresponding spectral type. ...

Еще в разделе: (Показать все результаты (>49) - xray.sai.msu.ru/ )

• Scenario Machine Engine

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>59) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Nosov Valentin Alexandrovich :: History of

... More Reports . ... Vocal repertoire in the Dhole Cuon alpinus in captivity // In: Canid Biology and Conservation, An International Conference, Oxford. Three independent structural components form the dhole vocal repertoire: the low tonal, the high tonal, and the pulsed one. On the base of the occurrence of the components the dhole vocal repertoire was represented as consisting of three vocal classes with eleven call types. ... Research * Student Reports . ...

Еще в разделе: (Показать все результаты (>43) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Moscow State University Belozersky Institute of Physico-Chemical Biology . Department of Electron Microscopy is a sub-division of A.N. Belozersky Institute of Physico-Chemical Biology . ... We are interested of how eukaryotic cell is organized, formed and functioned. Since A.N. Belozersky Institute of Physico-Chemical Biology is one of the scientific departments of Moscow State University ? ... Understanding the metaphase chromosome architecture remains a basic challenge in cell biology. ...

Еще в разделе: (Показать все результаты (>3) - cellbiol.genebee.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TES. Processing

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

... HPF-DVM) . Language specification . ... 5 ALIGN and REALIGN directives . ... Jacobi algorithm PROGRAM JACOBI PARAMETER (K=8, ITMAX=20) REAL A(K,K), B(K,K) *HPF$ DISTRIBUTE A (BLOCK, BLOCK) *HPF$ ALIGN B(I,J) WITH A(I,J) C arrays A and B with block distribution PRINT *, '******** TEST_JACOBI_HPF ********' C nest of two independent loops, iteration (i,j) will be executed C on processor, which is owner of element A(i,j) *HPF$ INDEPENDENT DO 1 J = 1, K *HPF$ INDEPENDENT DO 1 I = 1, K A(I,J) = 0. ...

Еще в разделе: (Показать все результаты (>115) - sp.cs.msu.ru/ )

• Fabrik - A Visual Programming Environment
• Fortran DVM language description
• C-DVM language description

... Алимов А.Р., ?Чебышевские множества в линейных пространствах с несимметричной сферой?, ... А.Р.Алимов, ?Всякое ли чебышевское множество выпукло?? Матем. просвещение , сер. 3, вып. ... А.Р.Алимов, ?Множества, чебышевские относительно нормы пространства Балаганского и евклидовой нормы?, ... А.Р.Алимов, М.И.Карлов, ?Множества с внешним чебышевским слоем?, ... Известия РАН, серия матем. ... Матем. заметки , 91 (2), (2012), 305-307. ... wiki/aalpubl.txt Последние изменения: 2014/02/01 19:48 ? ...

Еще в разделе: (Показать все результаты (>73) - new.math.msu.su/ )

... QUANTUM INFORMATION AND COMPUTATION Absolute Robustness of the First Principal Fourier State Component and Noise Suppression in Hilbert Space Yu. ... 2, Moscow, 119992 Russia e-mail: skulik@qopt.phys.msu.su Received March 28, 2006 Abstract--The effect of the absolute robustness of the first principal Fourier-state component is developed upon rounding off the density matrix elements. ... This is interpreted as the absolute robustness of the first principal component of the Fourier state density...

Еще в разделе: (Показать все результаты (>129) - qi.phys.msu.ru/ )

• Publications :: Quantum Information Laboratory

... Adds a gradient to the background of an element. ... Lorem ipsum dolor sit amet, consectetur adipiscing elit. Suspendisse ornare fringilla est, eget condimentum quam auctor quis. ... Phasellus tortor dui, viverra vitae molestie a, aliquam quis risus. Mauris fringilla mattis ligula, et laoreet dui rhoncus vel. Aliquam bibendum, nisi nec pellentesque convallis, augue elit rutrum sapien, nec molestie augue mauris et tellus. ... This topic: System > JQueryPlugin > JQueryGradient . ...

Еще в разделе: (Показать все результаты (>2132) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki
• HistoryPlugin < System < Foswiki

Laboratory work N7 Low-pass filtering. 1) Generate the signal with two periodic components and high-frequency noise. ... 2) Perform it's filtering with Panteleev filter 0 - h(t) = e 22 0 |t| 2 0 t 0 |t| cos + sin 2 2 , where 0 is a parameter. The frequency response of the Panteleev filter is ^ h( ) = 4 0 . 4 0 + 4 Select the cut-off frequency (by varying 0 ) for filtering out high-frequency periodic component and noise. 3) Plot the initial and filtered signal. ...

Еще в разделе: (Показать все результаты (>194) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/~tempus/english/science/articles/Poster_DZZ2015.pdf
• http://lnfm1.sai.msu.ru/~tempus/english/science/articles/ZotovPoster_APSG2013.pdf
• http://lnfm1.sai.msu.ru/SETI/koi/bulletin/12/arch1.html

... A This result can be applied to a wide variety of data sets, including electricity bills1, street addresses, lengths of rivers, physical and mathematical constants, and processes described by power laws. ... Based on the plausible4 assumption that people who make up figures tend to distribute5 their digits fairly uniformly, a simple comparison of first-digit frequency distribution from the data with the expected distribution according to Benford's law had to show up any anomalous results. ...

Еще в разделе: (Показать все результаты (>16) - www.eng.math.msu.su/ )

... In particular, Jmol.js uses the split version. ... To invoke JmolApplet.jar from Jmol.js, either: a) put it in the folder containing the HTML page requiring it and do not use jmolInitialize() or b) identify it explicitly in jmolInitialize(), for example: jmolInitialize("folder-containing-jar-files", "JmolApplet.jar") - JmolAppletSigned.jar An equivalent version of the applet, but this is a "signed" or "trusted" applet (a term in Java security language). ...

Еще в разделе: (Показать все результаты (>96) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP classification
• Example of supporting positions

... Phys. A25 (2010) 3933 (arXiv:0908.0457 [hep-ph]) A brief reminder AdS/CFT correspondence ­ the conjectured equivalence between a string theory defined on one space and a CFT without gravity defined on conformal boundary of this space. ... At one imposes certain gauge invariant boundary conditions on the fields. Equation of motion for the scalar field Solution independent of usual 4 space-time coordinates where M is identified with the quark mass matrix and with the condensate. ...

Еще в разделе: (Показать все результаты (>139) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2011/asymbrane_QFTHEP11.pdf
• http://qfthep.sinp.msu.ru/proceedings2015/Quant_Bezuglov.pdf
• http://qfthep.sinp.msu.ru/talks2013/QFTHEP-Golovnev.pdf