... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>1746) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) VarRENDERFORM < System < Foswiki
• (backlinks in System Web) VarRENDERFORM < System < Foswiki
• (backlinks in all Webs) VarSTARTSECTION < System < Foswiki

General Information . ... Local Information . ... The city represents great cultural value because in the late 19th and early 20th centuries, Kislovodsk as a fashionable spa attracted many musicians, artists, and members of the Russian aristocracy. ... Double room with full pension (breakfast, lunch, dinner) - 2620 rubles per person per night. solnechniy . ... Citizens of most countries need visa to enter the Russian Federation. ... Victor Kornilov, Sternberg Astronomical Institute (chair) . ...

Еще в разделе: (Показать все результаты (>9) - site2010.sai.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>61) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• MUSCLE 3.6
• Picornaviruses: discovering big in small

VISA SUPPORT FORM |Family name| ... Date of | birth | __________________________________ If there is the second (or moreover) citizenship they are specified through a point State of birth ____________________ place of birth _______________________________________ country exact place of birth State of inhabitancy _________________ region___________________________________________ country region in the state of inhabitancy The closest Russian Consulate where you will ask for visa: ...

Еще в разделе: (Показать все результаты (>9) - foroff.phys.msu.ru/ )

• Seminar in SRCC

... was placed onto the " The Science Wall of Honor " . This unique science wall of honor commemorating . thirty-seven of the world's " Immortals of Science " is located . ... at the campus of the University of Bridgeport . ... Bridgeport University ) . for the picture of the wall . ... Links and pictures composed by Eugene V. Babaev . back to Mendeleev Online ...

Еще в разделе: (Показать все результаты (>68) - www.chem.msu.ru/ )

• Конференция выпускников Химфака МГУ, работающих за рубежом

Here are some images of Australian currency. ... Some of the notes below are printed on paper, others are printed on a thin, flexible polymer (i.e. plastic). The polymer notes are fairly new - The Australian Mint is currently in the process of replacing all paper money with polymer. ... The front design features a portrait of Queen Elizabeth II of England, who is Australia's Head of State. ... This note is printed on paper, and is due to be replaced by a newly designed polymer note in 1996. ...

Еще в разделе: (Показать все результаты (>135) - xray.sai.msu.ru/ )

• The Instruments
• Chervon
• The ``Reflection'' Effect

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Conference Venue . Conference Opening ceremony will take place on Tuesday, June 17 at 13:00 in the MSU Library Building . ... On other conference days registration will be possible in the room 706 of the 2-nd Educational Building. ...

Еще в разделе: (Показать все результаты (>6) - pont2008.cmc.msu.ru/ )

... Main features of PPC: positive, motivational therapeutic Gospel - departure from negative language towards human; loving, giving God-friend and helper; felt needs placed in the center of ministry; accent on positive human nature; theology becomes a mission of local congregation; Christian doctrine replaced with psychology, sociology, marketing; emergence of new, diverse organizational forms, modified religious practice and contemporary worship. ...

Еще в разделе: (Показать все результаты (>11) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/4/13.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/4/01.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/4/04.pdf

LIPSKIY-RODIONOVA' LUNAR ANTIPODES AS PRECURSORS OF A REGULAR WAVE PLANETOLOGY G.G.Kochemasov IGEM of the Russian Academy of Sciences, Moscow, Russia kochem@igem.ru / Fax: (009)(095)230 21 79 The first observations of the lunar far side allowed to compare it with the near side and draw very important conclusions in the very beginning of planetary studies based on spacecrafts. ... Celestial bodies are dichotomic. ... The concept of celestial bodies includes Sun (a star) as one of them. ...

Еще в разделе: (Показать все результаты (>46) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.pdf
• http://selena.sai.msu.ru/Chik/Publications/ms40/17_Chikmachev_etal.pdf

University Satellites and Space Science Education" (Moscow, June 26-30, 2006). Brief report about the conference UNIVERSAUT-2006, which took place in Moscow, on June 26-30, 2006. Space and Education", Ulyanovsk, Octover 10-14, 2005. Photo-report about the school-seminar "Space and Education", which took place in Ulyanovsk, on October 10-14, 2005. ...

Еще в разделе: (Показать все результаты (>489) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006
• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,

... Science Festival will take place in Moscow on October 10-12 2014. Engineering Physics Laboratory will participate in the IX Science Fectival. During the Science Festival many events will take place: lectures by Nobel Laureates, lectures by eminent scientists and popularizers of science, meeting with astronaut, demonstration of the latest scientific developments and inventions. Engineering Physics Laboratory will show main projects and tell you about achievements. ...

Еще в разделе: (Показать все результаты (>76) - engineering.phys.msu.ru/ )

• Participation in IX Science Festival
• Science Festival 2015
• Meeting with the representatives of Russian Universities

... De winnaar van de DABIDA Hannie Sarris Award 2011 is geworden . Victoria Minenko uit de OekraОne . The winner of the DABIDA Hannie Sarris Award 2011 is . Victoria Minenko from the Ukraine . Victoria Minenko: Ukraine . De tweede prijswinnaar is geworden . Yulia Litvinova uit Rusland . Second place is for Yulia Litvinova from Russia . Yulia Litvinova : Russia . ... Nefer Kane uit Frankrijk . Third place is for Nefer Kane from France . Nefer Kane: France . ...

Еще в разделе: (Показать все результаты (>229) - chronos.msu.ru/ )

• Home - Institute for Time Nature Explorations

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>10) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

... General Information . ... For physics faculty . ... For natural faculties . ... Lomonosov Moscow State University is situated on the south-west of Moscow. The Department is placed at Physics Faculty, wich building is near the main building of MSU. ... Department of General Physics and magneto-ordered matter, . Faculty of Physics, . M.V.Lomonosov Moscow State University, . Leninskie gory, Moscow 119992, Russia . ... E-mail: . ...

Еще в разделе: (Показать все результаты (>4) - ferro.phys.msu.ru/ )

• Physics Department of Moscow State University

SN 1999aa - A Third Supernova Discovery . Just 9 weeks after the discovery of SN 1998ey a suspect was found 1" east and 28" north from the centre of NGC 2595 on Feb.11.0166 U.T.. ... Further inspection of 6 images of NGC 2595 taken during Feb. and March 1998 showed no object at the position of the suspect. ... Beijing Astronomical Observatory recorded SN 1999aa on Feb. 11.6 and 12.6 UT, the first obervation being only 14 hours after the discovery. ... Back to Supernova 1999aa in NGC 2595 . ...

Еще в разделе: (Показать все результаты (>28) - www.rochesterastronomy.org/ )

• Supernova 2000I in NGC 2958
• Supernova 2001B in IC 391
• Supernova 2001fc in UGC 11683

... Journal of Cell Science [ J Cell Science] . Common information . ... since 1853-01-01 till today . ... biology ->cell biology . ... Recent name [Quarterly Journal of Microscopical Science] - archive placed here. ... http://jcs.biologists.org . ... 1853-01-01 . ... http://jcs.biologists.org/contents-by... 1853-01-01 . ... http://jcs.biologists.org/contents-by.. ...

Еще в разделе: (Показать все результаты (>5) - journals.genebee.msu.ru/ )

. This text will be replaced

Еще в разделе: (Показать все результаты (>8) - polit.msu.ru/ )

• Untitled Document

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>19) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Official information

... Intracavity laser spectroscopy of the molecule HfCl. analysis of the rotational structure of the new bands 2 ?–x 2 ? ... Abstract The electron absorption spectrumof the molecule HfCl in the 550–800 nm regionby intracavity laser spectroscopy. ... Key words: HfCl, intracavity laser spectroscopy, rotational analysis, molecular constants. Moscow University Chemistry Bulletin . 2014, Vol. ... Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>142) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 56, No. 3, P. 164 (2015)
• Moscow University Chemistry Bulletin Vol. 49, No. 2, P. 102 (2008)
• Mechanism of the photochemical chain reaction of substitution of the sulpho

... February 9, 2004 . ... 9.02.2004 . 10 th Anniversary of the Golden Mask Festival . In spring 2004 the National Theatre Award and Festival 'Golden Mask' celebrates its 10th anniversary. ... This program marks the 10th anniversary of the Golden Mask Festival. (more.. ... The use of foreign words where suitable Russian ones exist has been forbidden under a new law passed by the Russian parliament. ... Russian proverbs and sayings about Russian language: . ...

Еще в разделе: (Показать все результаты (>21) - www.rlcentre.com/ )