... GeneBee . ... Advanced GeneBee Motifs' Collection Map . ... General options . Number of motifs to plot . Map title . Number of motifs to output . DotHelix options . ... Dothelix Power threshold . ... DotHelix . ... DNA/RNA Dayhoff Johnson Blosum 30 Blosum 50 Blosum 62 Pam 60 Pam 120 Pam 250 Gonnet 120 Gonnet 250 Gonnet 350 . Other options . ... Motif frequences . ... Comments and bug-reports send to: nik@genebee.msu.su ...

Еще в разделе: (Показать все результаты (>50) - www.genebee.msu.ru/ )

• GeneBee Graphical Alignment - Advanced
• Screening by similarity
• Screening pattern or alignmemt against PROTEIN databank

Supernova 2001ba in ESO 439-G18 . This page is devoted to information on Supernova 2001ba in ESO 439-G18 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. Found by Robin Chassagne of Reunion Island (Indian Ocean). ... Icon created from Robin Chassagne's confirmation image. ... Robin Chassagne image . ...

Еще в разделе: (Показать все результаты (>4) - www.rochesterastronomy.org/ )

• Supernova 2005cs in M51

... Useful Information . ... Vestnik CIE (in Russian) . ... Information about Russia . ... With an area of 17,075,200 square kilometres, it is the largest country in the world by land mass, covering almost twice the territory of the next-largest country, Canada. ... Formerly the dominant republic of the Union of Soviet Socialist Republics (USSR), Russia is now an independent country and an influential member of the Commonwealth of Independent States, since the Union s dissolution in December 1991. ...

Еще в разделе: (Показать все результаты (>2) - www.cie.ru/ )

... Литература . ... Aniello C.A. Using Landsat-TM thermal data to map micro-urban heat islands in Dallas, Texas. ... Dousset B., Gourmelon F. Satellite multi-sensor data analysis of urban surface temperatures and landcover // ISPRS Journal of Photogrammetry Remote Sensing, 2003, ?58, p. 43-54; . Gluch R., Quattrochi D.A., Luvall J.C. A multi-scale approach to urban thermal analysis // Remote Sensing of Environment, 2006, ?104, p. 123-132; . ... The social impacts of heat waves: science report. ...

Еще в разделе: (Показать все результаты (>87) - www.geogr.msu.ru/ )

• CONTENTS ?4 - 2011
• CONTENTS ?6 - 2011
• CONTENTS ? 5 - 2013

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Конференции . ... Новости для выпускников . ... База данных выпускников . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Тема "Johnson Johnson приглашает студентов и выпускников" . ... жизни других людей? ... атмосферой маленькой компании? ... и выпускников вузов на позицию Младший специалист по продукции. ... Ежедневно продукция Johnson Johnson Medical спасает тысячи людей по всему миру. ... http://www.jnj.com , . ...

Еще в разделе: (Показать все результаты (>154) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Конференция "Выпускники МГУ в Канаде"
• Клуб выпускников МГУ: Чередование жизненных функций в человеческом организме
• Клуб выпускников МГУ: Обсуждение материала "Чередование жизненных функций в

... структура порожденного им редуцированного процесса, распределение момента рождения ближайшего общего предка всех частиц, существующих в популяции в далекий момент ближайшим общим предком. n , а также тип частицы , являющейся March 19 A. V. Vatutin N ( Steklov Mathematical Institute) Macroscopic and microscopic structures of the decomposable critical branching process A decomp osable strongly critical Galton-Watson branching pro cess with typ es of ... Particles of island N do not...

Еще в разделе: (Показать все результаты (>6) - new.math.msu.su/ )

... The term " safety culture " appeared in 1988, it has been stipulated by the Chernobyl catastrophe. ... Different definitions will be collated in the presentation; a necessity to develop a quantitative approach to safety culture will be demonstrated. ... What is the role of human errors in safety culture? Operators are often the weak link in any complex system, they are one of the biggest sources of errors in high-risk technologies. ... How to quantify human errors? ...

Еще в разделе: (Показать все результаты (>11) - www.prof.msu.ru/ )

• One effective method to turn passive students into active learners in Russian

The International Society for the Study of Time Fifteenth Triennial Conference Time and Trace June 30 - July 6, 2013 Orthodox Academy of Crete http://www.oac.gr/htm/main_en.html Call for Papers Proposals (300 words) due by June 30th, 2012 The International Society for the Study of Time (ISST) seeks proposals for presentations at its 2013 conference on the island of Crete, on the theme of Time and Trace. ... Works of literature were also called "brush traces" (hisseki) in Japanese. ...

Еще в разделе: (Показать все результаты (>71) - chronos.msu.ru/ )

• С Новым годом

... Parent Directory / . Directory . Japan, Tsunami. Coast Guard ship rides over the tsunami waves.wmv . 2014-Sep-17 18:54:26 . ... video/x-ms-wmv . ... Japan Nov 2013.wmv . ... Physics of tsunamis 02_rip.pdf . ... Rissagues y Meteo-tsunamis.wmv . ... Volcano Tsunami.mov.wmv . ...

Еще в разделе: (Показать все результаты (>5) - ocean.phys.msu.ru/ )

RFBR/DFG грант 96-01-00028/Ei 280/2-1: Indextheorie und numerische Invarianten fur Mannigfaltigkeiten. Сотрудничество с немецкими исследовательскими группами J.Eichhorn (Greifswald), Th.Friedrich (Berlin), W.Luck (Munster). http://www.math-inf.uni-greifswald.de/analysis/eichhorn/ International Conference "Dirac operators, index theorems and numerical invariants of manifolds" (Usedom Island, Germany, March 7-13, 1999) 30 min. talk

Еще в разделе: (Показать все результаты (>7) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/OrgConferences/ger68.txt

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. September 4, 1998 . Nozomi: Earth and Moon . Credit: Nozomi MIC Team , ISAS . ... This stunning picture of the crescent Earth-Moon system was taken by Nozomi's onboard camera on July 18 from a point in space about 100,000 miles from the Earth and 320,000 miles from the Moon. ... About APOD > . ...

Еще в разделе: (Показать все результаты (>2) - www.arcetri.astro.it/ )

FT CDS join(224735..224850,226744..226816) FT /codon_start=1 FT /gene="gs19" FT /product="unknown" FT /note="GENSCAN prediction; no supporting EST/Peptide FT evidence known at this time; supported by a CpG island" FT /db_xref="HGNC:14163" FT /db_xref="UniProtKB/TrEMBL:Q96S31" FT /protein_id="AAK61219.1" FT /translation="MAWGGVGACAFPPPPARLVGSDARGRGQRRGRVRGRGGRLLASIL FT LTSNGCLLLVTTQSLMD"

Еще в разделе: (Показать все результаты (>51) - kodomo.cmm.msu.ru/ )

• VIPERdb Database

... The burberry scarfs is to get a product of evolutionary level. ... Look at how many girls make the . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>11) - elana.sinp.msu.ru/ )

... FFTW - Acknowledgments . ... Steven G. Johnson was supported in part by a DoD NDSEG Fellowship, an MIT Karl Taylor Compton Fellowship, and by the Materials Research Science and Engineering Center program of the National Science Foundation under award DMR-9400334. ... The genfft program was written using Objective Caml, a dialect of ML. ... In previous releases of FFTW, genfft was written in Caml Light, by the same authors. ... This program would not exist without him. ... Центры . ...

Еще в разделе: (Показать все результаты (>16) - www.parallel.ru/ )

William Gillette Professor of History Ph.D., Princeton M.A., Columbia B.S.F.S., Georgetown At Rutgers Since 1967 · 219 Van Dyck Hall 732-932-6779This e-mail address is being protected from spam bots, you need JavaScript enabled to view it RESEARCH INTERESTS · Civil War and Reconstruction, New Jersey history , American political history , American Western ... Irving L. Gordon, Review Text in American History, pp. ... Lecture 10: Politics of Activism and John Kennedy: April 16 Readings: 1. ...

Еще в разделе: (Показать все результаты (>25) - hist.msu.ru/ )

Russian Gapping: evidence for deletion ATB-movement approaches to Gapping (Zoerner 1995, Steedman 2000, Johnson to appear) explain why Gapping is restricted to coordinate sentences and cannot affect an embedded verb when the matrix one is retained. ... Data (1) Biznesmen podvergsja napadeniju i businessman was.exposed attack.DAT and ranenija, a ego voditel' polucil tri injuries CONJ his driver got three The businessman was exposed to an attack and got two inj injuries. ...

Еще в разделе: (Показать все результаты (>50) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~rkigf/P_Objavlenija/Konferencii/Konferencii_2011/2011_09_Grec_cml2011-CFP.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/mitrenina.pdf
• http://www.philol.msu.ru/~smu/work/science-day/2010/24-1-4.pdf

... Research . ... Linguistic expeditions . ... Up to now the subjects to documentation were local dialects of Selkup, Ket, and Evenki. ... 1) creation and enlargement of multimedia computer archives of Selkup, Ket, and Evenki speech, which include sounding dictionaries and folklore texts and life-stories in audio, video, and graphic representation in local dialects of the surveyed villages; development of linguistic multimedia databases; . ... 8) research into the Selkup-Ket-Evenki language contacts; ....

58. Emerging evidence for a similar role of glutamate receptors in the nervous and

59. Department of Physical Geography and Landscape Science

60. LOCAL TSUNAMI WARNING AND MITIGATION -- Proceedings Download Page