Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>19) - foroff.phys.msu.ru/ )

... John Backus in New Mexico, 1976 . ... Other manufacturers came later with Fortran compilers for their machines and in 1962 IBM introduced the extended Fortran IV, which was the base for the 1966 agreed American standard ANSI X3.9 - 1966. ... An HTML version of the Fortran 77 Standard is now available! ... The purpose of the work on a new standard version was to make Fortran usable and efficient language for scientific and technical computations during the nineties. ... Parallel execution . ...

Еще в разделе: (Показать все результаты (>2807) - crydee.sai.msu.ru/ )

• Long description for example of clipping region
• Explanation of certain terms
• Image: Coast is pretty different here -- from beaches to unclimbable rocks.

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>23) - observ.pereplet.ru/ )

Russian Interdisciplinary . Temporology Seminar: . ... Journals about time . ... 1 October, Tuesday . ... Physical models of torsion fields, making it possible to describe their action upon living matter, are considered. ... EVOLUTION WITHOUT SELECTION OR SELECTION BEFORE EVOLUTION?" ... The structure equality of energy and time in the action parameter, which is minimized on the trajectories of free uniform motion, inspires one to seek the conditions for their physical interchangeability. ...

Еще в разделе: (Показать все результаты (>377) - chronos.msu.ru/ )

• Rational Fertilization of Fish Ponds Populated by Different Species
• Блок Р. (Block R.)
• M. H. Shulman

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>14) - mouse.belozersky.msu.ru/ )

• Blocks finder
• wLake program homepage

.

Еще в разделе: (Показать все результаты (>104) - www.chemport.ru/ )

• Real estate market monitoring november 2009 4 сезона торговый дом ооо 70

... Blocking receive . Up: Blocking Send and Receive Operations Next: Return status Previous: Message envelope . ... MPI_RECV (buf, count, datatype, source, tag, comm, status) . ... A message can be received by a receive operation if its envelope matches the source, tag and comm values specified by the receive operation. The receiver may specify a wildcard MPI_ANY_SOURCE value for source, and/or a wildcard MPI_ANY_TAG value for tag, indicating that any source and/or tag are acceptable. ...

Еще в разделе: (Показать все результаты (>374) - www.parallel.ru/ )

• Progress | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Message data | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Special features of different systems | PARALLEL.RU -

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>164) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction
• Notes on searching by similarity

О лаборатории . ... Лаборатория теоретической биофизики . ... ERG group members work with different types of molecules and consequently added new atomtypes into classical OPLS-AA distributed with GROMACS. Now the ERG patch of OPLS-AA force field is published at bitbucket as a repository. ... Нет комментариев " OPLS-AA patch for different types of molecules " . ... OPLS-AA patch for different types of molecules . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2016 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики

... In the meanwhile, Fred continued development, going on to Net-2e, which features a much revised design of the networking layer. ... Most notable about Net-2e is the incorporation of DDI, the Device Driver Interface . ... For this, he integrated some of the BSD networking code in the kernel. ... This only applies to commands that deal with kernel internals rather closely; applications and common networking commands such as rlogin or telnet run on either of them. ...

Еще в разделе: (Показать все результаты (>300) - itpm.msu.su/ )

• Using Disks and Other Storage Media
• Formatting
• Multi-Processing Modules (MPMs) - Apache HTTP Server

To see a Russian version of this page, click here . ... Bochkarev Nikolai Gennadievich . astrophysics researcher: . born: Moscow, May 19, 1947; . ... Jr. researcher Sternberg Astronomical Inst., ... Soviet (Russian) Working Group on Interstellar Matter, Moscow , 1979-; . ... Madison, 1991. ... ALocal Interstellar Matter, 1990, . Basic Physics of the Interstellar Matter, 1992; co-author: . ... Physics of Interstellar Matter, 1979; . ... All-Union Astronom. Geodesical Soc., ... Astronom. ...

Еще в разделе: (Показать все результаты (>9) - uranus.sai.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>53) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Unsolved problems and new prospects
• Other prospects of the change-point based analysis

Pentium 4 2.2 GHz . ... Pentium D 3.0 GHz, serial . Pentium D 3.0 GHz, parallel or multithreaded . ... input , output ) . ... Pentium 4 2.2 GHz , P4B (Northwood), 512 Kb L2 cache, no HTT support, 2200 MHz, 400 MHz FSB, 512 MB PC800 RamBus RIMM RDRAM, 60 GB IDE HDD, Windows 2000 Professional SP4. ... Serial - PC GAMESS is running using only one core . Parallel or multithreaded - PC GAMESS is running using only both cores in parallel (tests 1,3,5,6) or multithreaded (tests 2 and 4) modes. ...

Еще в разделе: (Показать все результаты (>80) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - MPI bindings for Windows

... The Output Control functions allow you to control when output is sent from the script. ... The Output Control functions do not affect headers sent using header() or setcookie() , only functions such as echo() and data between blocks of PHP code. ... In the above example, the output from echo() would be stored in the output buffer until ob_end_flush() was called. ... ob_start -- Turn on output buffering . ... ob_end_flush -- Flush (send) the output buffer and turn off output buffering . ... flush ...

Еще в разделе: (Показать все результаты (>288) - oit.cmc.msu.ru/ )

• switch
• PostgreSQL functions
• mcrypt_module_is_block_mode

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>720) - monkey.belozersky.msu.ru/ )

• SCOP classification
• Inquiry information || Schemes of phylogenetic trees
• About this project

V.A. Khokhlova, M.R. Bailey, P.J. Kaczkowski, B.W. Cunitz, J. Reed, M. Nakazawa, and L.A. Crum. ... V.A. Khokhlova. ... O.A. Sapozhnikov, R. Cleveland, M.R. Bailey, L.A. Crum. ... V.A. Khokhlova, M.A. Averkiou, M.A. Bailey, and L. A. Crum. ... V.A. Khokhlova, P.J. Kaczkowski, B.W. Cunitz, M.R. Bailey, and L.A. Crum. ... In: Book of Abstracts of the, 3.32B. V.A. Khokhlova, M.A. Averkiou, A.E. Ponomaryov, L.A. Crum. ... A.E. Ponomaryov, V.A. Khokhlova, M.A. Averkiou, and L.A. Crum. ...

Еще в разделе: (Показать все результаты (>43) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/conference.htm

... Okhapina, E. Y. The Boundary Zones of the Eastern Urals . Natural restrictions of the East Uralian structures are two intensive deformed boundary zones, which are the Sheludivy Gory Boundary Zone (SGBZ) in the west and the Redutovo Boundary Zone (RBZ) in the east. SGBZ represents a package lens-shaped and steeply dipping faulted blocks, horizontal dimension of which usually does not exceed 2 km. ... Deformation degree in this boundary zone are significantly higher than in the former. ...

Еще в разделе: (Показать все результаты (>14) - sbmg.geol.msu.ru/ )

• Calendar Converter

... MBA . EXECUTIVE MBA . ... Международные связи . ... Международная конференция в Риге 'Define Europe - Different Sculptors, One shape' . ... В конференции примут участие представители различных международных организаций: . ... Янис Биркс (Janis Birks) - Мэр г. Рига и др. ... Конференция будет проходить в Риге, Латвия с 8 по 11 Октября 2009 года. ... Executive MBA . ... Членство в международных образовательных ассоциациях и альянсах . ...

Еще в разделе: (Показать все результаты (>72) - www.mgubs.ru/ )

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30 љ љљ 736 - 1.ГУМ . ... Морозова Е.Б. пн. љ17-00? 18-30, 18-45?20-15, 20-30?21-15љ 1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг љ15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

... The pivotal role of the beta 7 strand in the intersubunit contacts of different human small heat shock proteins. ... It is concluded that the beta 7 strand participates in the intersubunit interaction of four human small heat shock proteins (alpha B-crystallin, HspB1, HspB6, HspB8) having different structure of beta2 strand of alpha-crystallin domain and different length and composition of variable N- and C-terminal tails. ...

Еще в разделе: (Показать все результаты (>72) - biochem.bio.msu.ru/ )

• [Different domain organization of two main conformational states of
• Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein