... Electronic journal Issue 4. 10 september 2004 Ulrich M. Sustainable Management of Natural Resources Introduction. ... To learn about the dynamics of natural resource management and the tragedy of the commons by means of a direct experience in the simulation game «NEW COMMONS GAME». ... 2) Tragedy of the commons and management of natural resources. ... The simulation game was followed by a short debriefing on the dynamics of the tragedy of the commons and natural resource management. ...

Еще в разделе: (Показать все результаты (>8) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>124) - www.genebee.msu.ru/ )

• BioSystems, 30 (1993) 57-63 57
• GeneBee BLAST 2.2.8 Services
• DIMACS Series in Discrete Mathematics and Theoretical Computer Science Volume

... You can boot Linux either from a floppy or from the hard disk. ... When booting Linux from a floppy disk, the boot sector contains code that just reads the first few hundred blocks (depending on the actual kernel size, of course) to a predetermined place in memory. On a Linux boot floppy, there is no filesystem, the kernel is just stored in consecutive sectors, since this simplifies the boot process. ... For example, when I boot, I it looks like this: LILO boot: Loading linux. ...

Еще в разделе: (Показать все результаты (>365) - itpm.msu.su/ )

• Different Streaks of Development
• Boots And Shutdowns
• MySQL Reference Manual for version 3.23.10-alpha. - E Known errors and design

... Since then, military men have cropped their hair close to the scalps. ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>88) - elana.sinp.msu.ru/ )

• maybe a jacket having a boxier cut is more flattering. Maybe it was hard
• September 26 | С Днем Победы!

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>14) - sbmg.geol.msu.ru/ )

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>177) - comet.sai.msu.ru/ )

• Comparing files
• Comparing directories
• About RadioAstronomy Dept. of SAI

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>110) - www.prof.msu.ru/ )

• Eleven years of independence
• Венедиктова Татьяна Дмитриевна
• Discovering America

The quantitative probabilistic model of the solar energetic particle fluxes description by R.A.Nymmik from Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, 119991, Moscow, Russian Federation, nymmik@sinp.msu.ru Abstract The description of a quantitative probabilistic model for peak fluxes and fluences of solar energetic particles from protons up to Ni ions is presented. ... Nymmik R.A. Probabilistic model for fluences and peak fluxes of solar energetic particles, Rad. ...

Еще в разделе: (Показать все результаты (>22) - smdc.sinp.msu.ru/ )

Since version 5.2 (May 1999), the PC GAMESS (now Firefly) had included closed-shell MP4(full) (a.k.a. MP4(SDTQ) or MP4-SDTQ) module, which we believe, was a kind of the real state of the art. ... Table I. Standard MP4(SDTQ) benchmark, time/performance data for the most expensive N 7 MP4(T) step (43.057 10 12 Double Precision Floating Point operations using DGEMM, size of matrices: 217x193). ... 561.00 seconds (76.75 GFlop/s) using all available CPU cores for computations and no GPUs at all . ...

Еще в разделе: (Показать все результаты (>86) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - SMP, multicore and HTT features
• Firefly and PC GAMESS archives
• PC GAMESS v. 7.0 benchmarks on different Intel Pentium 4 family (Netburst)

... Home . ... Faculty . ... Your email * . ... Send to * . ... CMC MSU students at GSIS Summer School, Tohoku University, Japan . ... Second CMC MSU ? GSIS Tohoku Joint IT Seminar . ... CMC MSU ? ... Delegation from Tohoku University (Japan) at CMC MSU . ... The Faculty Site is in the adjustment state. Any comments on the contents and functioning of the site should be addressed to cmcproject@cs.msu.ru . 1996?2016 ї Faculty CMC Lomonosov Moscow State University . ... About this site . ...

Еще в разделе: (Показать все результаты (>232) - en.cs.msu.ru/ )

... Templates . ... The number n of unchanged sections which should be shown around changed sections. ... See section Templates below . ... The templates themselves are broken into 7 parts: template for start of page %REPEAT% template for unchanged section which is not printed according to context %REPEAT% template for unchanged section which is printed %REPEAT% template for changed section %REPEAT% template for added section %REPEAT% template for deleted section %REPEAT% template for end of page . ...

Еще в разделе: (Показать все результаты (>5417) - wiki.cmc.msu.ru/ )

• (compare) WebHome < Main < Foswiki

Compares two revisions of a document. ... Templates . ... The CompareRevisionsAddOn compares two revisions of a document, like rdiff does. But in contrast to normal rdiff , the comparison is done with the rendered HTML output of the revisions instead of the Foswiki source text files. ... Screenshot of interwoven output: . ... See section Templates below . ... In the templates for a section, %TEXT1% is replaced by the text of the old revision and %TEXT2% is replaced by the text of the new revision. ...

Еще в разделе: (Показать все результаты (>1874) - wiki.cs.msu.ru/ )

• (more) VarVARCACHE < System < Foswiki
• (more) WebNotify < Lectures < Foswiki
• (more) WebLeftBar < Lectures < Foswiki

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>23) - www.sai.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... closed] Не открывается задняя дверь на Lacetti . ... Re: [need help] Не открывается задняя дверь на Lacetti [ re: RAY ] . ... http://nubira-lacetti.ru/?p=168 . ...

Еще в разделе: (Показать все результаты (>2649) - www.snto-msu.net/ )

• closed - Public forum of MSU united student networks
• [CLOSED] Нужон стойкий PHP-разраб на 1.5-2 мес., довести до ума... - Public
• Коврик для оптической мыши КУПЛЮ [closed] - Public forum of MSU united student

... Measurement of B-type natriuretic peptide by two assays utilizing antibodies with different epitope specificity. ... DESIGN AND METHODS: Plasma samples (n=94) from HF patients were analyzed by the novel-type "Single Epitope Sandwich" (SES assay prototype) and the conventional-type Siemens ADVIA Centaur BNP assays. ... RESULTS: The SES assay measured 1.2- to 7.2-fold (2.1+/-0.9; mean, SD) greater BNP concentrations compared to the Siemens assay. ...

Еще в разделе: (Показать все результаты (>83) - biochem.bio.msu.ru/ )

• Redox-dependent change of nucleotide affinity to the active site of the
• Attempt to optimize some properties of fluorescent chimeras of human small heat
• The pivotal role of the beta 7 strand in the intersubunit contacts of different

Dear Polyslavists, The next annual meeting of Polyslav takes place between 25th and 27th of september 2009 in Hamburg. The closing date for submissions is 31 January 2009, so, please fill out the attached application form and send it back to us till January 31rd. ... If You need accomodation in Hamburg, please specify this in the attached application form so that we are able to make reservations in time. ... Registration for POLYSLAV XIII Hamburg, 25th-27th september 2009 |1. | ... need | ...

Еще в разделе: (Показать все результаты (>310) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Lexical_semantics@ALT_2003.pdf
• http://www.philol.msu.ru/~otipl/new/mscl/2008/abstracts/ramaglia.pdf
• Московское типологическое общество :: МГУ :: Филфак :: ОТиПЛ

... 231 Mathematical Statistics and Problems of Ancient Chronology. ... The methods are applied to the problem of correct dating of the events in ancient chronology. These results induce conjecture on the redating of some historical events. ... We call such texts statistical duplicates. ... Fomenko, A. T.: New Experimental and Statistical Methods for Dating Events of Ancient History and Applications to Global Chronology of Ancient World and Middle Ages, British Library, Dept. of Printed Books, Cup. ...

Еще в разделе: (Показать все результаты (>87) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/fomenko/fomenko4.pdf
• http://hbar.phys.msu.ru/gorm/fomenko/fomenko3.pdf
• http://hbar.phys.msu.ru/gorm/fomenko/fomenko5.pdf

... Academic Programmes . ... NEW Dates Price . ... 4 weeks minimum . ... TUITION FEES . ... Full-Time Tuition - 2 6 academic hours per week : . ... Part-Time Tuition - 18 academic hours per week : . ... If paid in several installments, course fees are calculated at the rate of US $ 150 per week for full-time tuition and US $ 120 per week for part-time tuition. ... 1 Full-Time Tuition (24 academic hours per week) US $ 1 95 per week . ... Part-Time Tuition (20 academic hours per week) US $ 1 70 per week ...

Еще в разделе: (Показать все результаты (>20) - www.cie.ru/ )

• Tuition Fees :: Admissions :: CIE
• Study Periods :: Admissions :: CIE
• Frais de scolarit? :: Condition d??tudes :: CEI

... Structure of Data . ... Catalog . ... In SAI OCL Catalog, we introduce our work on investigation of the Milky Way system of open star clusters. The main goal of our study is a search for new clusters using huge surveys. 168 new clusters have been already discovered by us using J,H,Ks data from 2MASS point source catalog. ... For 141 new clusters, we found their physical parameters using J,H,Ks data from 2MASS catalog and, for a number of clusters, our UBVRI CCD observational magnitudes. ...

Еще в разделе: (Показать все результаты (>218) - ocl.sai.msu.ru/ )