... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>160) - www.pereplet.ru/ )

... Ringing effect so known as Gibbs phenomenon in mathematical methods of image processing is the annoying effect in images and video appeared as rippling artifact near sharp edges. ... PDF . ... Framework for image ringing artifact analysis // In: Proceedings of 14-th International Conference and Exhibition ?Digital Signal Processing and its Applications? ... Scale-space method of image ringing estimation // In: Proceedings of International Conference on Image Processing (ICIP'09) . ...

Еще в разделе: (Показать все результаты (>190) - imaging.cmc.msu.ru/ )

... Faculty of Physics . ... MSU Physicists (Prof. V.S. Chernysh, Dr. A.E. Ieshkin, Faculty of Physics, and Senior Researcher Yu.A. Ermakov, Scobeltsyn Nuclear Physics Research Institute, MSU) discovered a new mechanism of sputtering with cluster ion beams. A cluster is an assembly of atoms or molecules which quantity is in range from a few up to a few tens of thousands units per cluster. ... Recent decades, interaction of cluster ions with solids has been under extensive investigation. ...

Еще в разделе: (Показать все результаты (>126) - phys.msu.ru/ )

... Although it is true that geologists call a lithified sand a sandstone regardless of age or hypothetical origin, it is equally true that degree of lithification plays no part in the stratigraphy of sediments. ... If you are describing a lithified sedimentary sequence with buried soils, it stands to reason that they would be lithified too. ... A geosol has to be buried where it is defined; otherwise, its stratigraphic position cannot be recognized. ...

Еще в разделе: (Показать все результаты (>160) - www.fadr.msu.ru/ )

• ESSAY
• Untitled

... About lab . ... Detection and correction of unnatural purple colors in images of refractive objects taken by digital still camera . ... color calibration , color correction , color management , digital still camera , light dispersion , monochromatic colors , perceptually uniform color spaces , RAW-processing . ... We discovered significant error in color in images produced by a digital still camera used to capture scenes with a special setup of illumination and an object. ...

Еще в разделе: (Показать все результаты (>214) - graphics.cs.msu.ru/ )

• Skin detector | Graphics and Media Lab
• Skin detector | Лаборатория компьютерной графики и мультимедиа
• Digital Microscope | Graphics and Media Lab

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Samus N.N. , Ipatov A.P. , Smirnov O.M. , Kravtsov V.V. , Alcaino G. , Liller W. , Alvarado F. в журнале Astronomy Letters , издательство Maik Nauka/Interperiodica Publishing (Russian Federation) , том 21, ? ...

Еще в разделе: (Показать все результаты (>2571) - istina.msu.ru/ )

• Alvarado F. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Zeitschrift Fur Physik D-Atoms Molecules and Clusters - журнал | ИСТИНА -
• Journal of Cluster Science - журнал | ИСТИНА - Интеллектуальная Система

... wLake 1.7 . wLake is a tool which allows to identify clusters of a structural water molecules in given superimposed 3D structures. Put your coordinates in PDB format into the text area. Select a distance threshold. Two water molecules from different structures will be concidered as located in the same space point if the distance between centers of oxygen atoms is less than this threshold. ... EACH STRUCTURE INCLUDING ITS WATER MOLECULES MUST BE PRESENTED AS SEPARATE MODEL: EXAMPLE. ...

Еще в разделе: (Показать все результаты (>71) - mouse.belozersky.msu.ru/ )

• MTPro
• Cluster 114
• Cluster 12

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>150) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Notes on searching by similarity
• DIMACS Series in Discrete Mathematics

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Узнать цвет пикселя. Работа с видеопамятью. С/С++ [ + OpenGL ? ... На входе координаты пикселя, на выходе например (255, 0, 0 ) если красный. ... OpenGL тебе не поможет. ...

Еще в разделе: (Показать все результаты (>3560) - www.snto-msu.net/ )

• vote is not defined - Public forum of MSU united student networks
• Массив констант и директива #define. - Public forum of MSU united student

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Technological Institute for Superhard and Novel Carbon Materials . ... Therefore, in solving the problems will be applied as specialized methods for the study of polyatomic structures - the method of empirical potentials Brenner . ... AREA: Condensed Matter Physics, Theoretical Physics, Physical Chemistry . ... Moscow State Uiversity . ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• CLEO: USER & ADMIN-FRIENDLY CLUSTER BATCH SYSTEM | Moscow University
• APPLICATIONS: Mathematics | Moscow University Supercomputing Center
• Welcome to HPC.MSU.RU! | Moscow University Supercomputing Center

Heavy-ion collisions in modified AdS spaces Pozdeeva E.O based on work I.Ya. ... Gubser, Klebanov, Polyakov, 9802109 Witten, 9802150 The gravitational shock wave in AdS 5 space is dual to ultrarelativistic heavy-ion in 4D space-time. ... DISCREPANCY The simple holographic model gives dN c h / d s 2/ 3 The mininal black hole entropy can be estimated by trapped surface area S S trapped =A trapped / 4G N The trapped surface is surface whose null normals all propagate inward. ...

Еще в разделе: (Показать все результаты (>166) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/QFTHEP-Katanaeva.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks/rep_Yu_QFTHEP.pdf

When reading scientific papers, listening to scientific reports and even looking through usual newspapers and magazines, we sometimes find different funny things. ... The same bands were later observed in the gase phase by Evans, using the technique of intensification by added oxygen. Evans boldly put 50 atm of ethylene in a cell with 25 atm of oxygen. ... This was a real experiment description in a scientific journal.) ...

Еще в разделе: (Показать все результаты (>107) - www.inorg.chem.msu.ru/ )

• CLUSTERS AND EXTENDED METAL-META

Angular Momentum of Spin Light Radiation V. A. Bordovitsyn, O. A. Konstantinova Tomsk State University, Lenin avenue 36, 634050 Tomsk, Russia Introduction Spin light [1] corresponds an electromagnetic radiation of a relativistic spin particle with a proper magnetic momentum. ... Motivation Exploration of spin light properties associated with the proper angular momentum of radiation of electromagnetic field. ... All the invariants of the electromagnetic field are zeros according to our hypothesis. ...

Еще в разделе: (Показать все результаты (>191) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Kataev.pdf

... О UNИX . ... Неизменяемая страница . ... Processing Instructions . ... redirect . ... pragma . ... deprecated . ... MoinMoin processing instructions have the same semantics as in XML: they control the paths taken when processing a page. ... For more information on the possible markup, see HelpOnEditing . Processing instructions MoinMoin knows of: . ... Redirect to a different page (see PageRedirect ) #REDIRECT pagename . ... Sets processing modes for this page: #PRAGMA mode arguments . ...

Еще в разделе: (Показать все результаты (>145) - uneex.mithril.cs.msu.su/ )

• HelpOnVariables - UNИX
• HelpOnSlideShows - UNИX
• HelpOnGroups - UNИX

Available online at www.sciencedirect.com BioSystems 92 (2008) 122­131 Objective patterns in the evolving network of non-equivalent observers Abir U. Igamberdiev Department of Biology, Memorial University of Newfoundland, Main Campus, St. John's, NL A1B 3X9, Canada Received 15 October 2007; received in revised form 15 January 2008; accepted 17 January 2008 Abstract The world 's objective pattern is formed through consistent histories of ... Time in biological systems. ... Anticipatory Systems. ...

Еще в разделе: (Показать все результаты (>392) - chronos.msu.ru/ )

• M.Shulman
• M. H. Shulman
• The New Yorker Reporting & Essays

... to See Comet Hale-Bopp . ... An Online Viewing Guide from . Sky & Telescope . Above: Sky & Telescope 's Dennis di Cicco obtained this view of Comet Hale-Bopp before the start of morning twilight on March 12th at a dark-sky location south of Boston, Massachusetts. ... For more information about Comet Hale-Bopp, including tips on viewing it through a telescope and capturing images with conventional or electronic cameras, please see the March and April 1997 issues of Sky & Telescope magazine. ...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• The International Olympiad of Euro-Asian Astronomical Society

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

• Spatial synchronization of the change-points
• Change-point synchronization between signals or signal components
• Change-points at different levels of the hierarchy of EEG segmental...

... 8 OpenFlow , , , , , , NAT, ARP, DNS, DHCP, BGP , , web · ­ · events per second · >10M · "" ­ · us · ­ 24/7 · ­ : ­ (2013) · · · · · · · · · NOX-Classic NOX Beacon Floodlight SNAC Ryu POX Maestro Trema · · · · · · · · · Helios FlowER MUL McNettle NodeFlow Onix SOX Kandoo Jaxon · Cisco ONE controller · Nicira NVP Controller · Big Network Controller · IBM Programmable Network Controller · HP SDN Controller · NEC Programmable Flow 11 · ­ ­ · ­ · ­ · ­ OpenFlow 12 5/30/2013 13 (2013) · 7 000 000 . ...

Еще в разделе: (Показать все результаты (>5) - lvk.cs.msu.su/ )

... Version history . ... Fortran-DVM and C-DVM languages supported data distribution by equal blocks and corresponding distribution of parallel loop iterations (data parallelism). ... A new toolkit - DVM-program performance analyzer was included in the version. ... Fortran-DVM and C-DVM languages support now data distribution by non-equal blocks and parallel executed program section specification (task parallelism). ... The version 3.30 (27.12.2000) is differ from version 3.15 in the following: . ...

Еще в разделе: (Показать все результаты (>110) - sp.cs.msu.ru/ )

• DVM debugger. Detailed design. Part 4
• DVM-system. Goals and structure
• Fortran DVM language description. Part 1 (1-4)

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Unknown (undefined) flying bugs . ... Re: Unknown (undefined) flying bugs [ re: kaiafa ] . ... Re: Unknown (undefined) flying bugs [ re: exuperantia ] . ...

Еще в разделе: (Показать все результаты (>5244) - www.fds-net.ru/ )

• vote is not defined - Public forum of MSU united student networks
• Объясните, пожалуйста, сакральный смысл #define - Public forum of MSU united
• Queer as Folk (UK) - Public forum of MSU united student networks