... О UNИX . ... Adding a favicon to your wiki setup . ... Serving the wiki from wiki.domain.com and home page from www.domain.com . ... If you have mail configured for your MoinMoin wiki (see HelpOnConfiguration ) then users can have their password sent to the email address given in their user preferences (just click on Войти and read that page. ... There is no need for a ScriptAlias to moin.cgi, but you still need the alias to MoinMoin 's htdocs folder: Alias /moin_static160/ "/usr/share/moin/htdocs/"...

Еще в разделе: (Показать все результаты (>172) - uneex.mithril.cs.msu.su/ )

• HelpOnProcessingInstructions - UNИX
• HelpOnGraphicalEditor - UNИX
• Index of /static/GimpDoc_EnRu/images/filters

THE ROLE OF COMPUTER IN TEACHING-LERNING PROCESS Beldiga-Vasilache M.Gh., ... According to a study, students who use computer for learning at home, achieved higher scores than other children, is because lessons at the coputer complets teacher explanations with multimedia elements and virtual experiments. ... Computer training is the way in which the interaction of teaching and learning, between teacher and students, is the means of this computer. ...

Еще в разделе: (Показать все результаты (>208) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15798/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc150984/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15764/doc.pdf

When Apache starts, it connects to some port and address on the local machine and waits for incoming requests. By default, it listens to all addresses on the machine, and to the port as specified by the Port directive in the server configuration. ... There are two directives used to restrict or specify which addresses and ports Apache listens to. ... Listen can be used to make a single Apache server listen to more than one address and/or port. ... Syntax: Listen [ port | IP-address:port ] . ...

Еще в разделе: (Показать все результаты (>473) - oit.cmc.msu.ru/ )

• Unix/Mac OS X installs
• Unix/Linux installs
• Ming functions for Flash

Automatic term extraction based on feature combination" . Lukashevich N.V., Logachev Yu.M. The paper describes the method of extraction of two-word domain terms combining their features. The features are computed from three sources: the word usage statistics in a domain-specific text collection, the statistics of global search engines, and a domain-specific thesaurus. ... We show that the use of multiple features considerably improves the automatic extraction of domain-specific terms. ...

Еще в разделе: (Показать все результаты (>221) - num-meth.srcc.msu.ru/ )

• "Some features of solving the problems of mapping for allocation of chemical
• An open AlgoWiki encyclopedia of algorithmic features: from mobile to extreme
• "Shell models in rapidly rotating dynamo systems"

Cameras · ­ · · · · · · · · ! MATLAB · MATLAB · Let's design a camera Idea 1: put a piece of film in front of an object Do we get a reasonable image? ... Slide by Steve Seitz Shrinking the aperture Adding a lens A lens focuses light onto the film · Thin lens model: ­ Rays passing through the center are not deviated (pinhole projection model still holds) Slide by Steve Seitz Adding a lens focal point f A lens focuses light onto the film · Thin ...

Еще в разделе: (Показать все результаты (>13) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... Dynamic Chaos and Fractals in Speech Rhythm . ... But it's yet rather surprisingly that this especially physical approach has appeared even more productive for explanation of many effects in such far from an engineering area as stuttering. In this paper we show the large-scale Voice/Unvoice temporal structure of normal and destroyed acoustic speech signal possesses the dynamical regimes set. ...

Еще в разделе: (Показать все результаты (>233) - acs366.phys.msu.su/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Shipkova I. , Chekrygina Ju , Devizenko A. , Lebedeva E. , Syr"ev N. , Vysulin S. в журнале Solid State Phenomena , том 234, с. 633-636 . ... Chekrygina Ju , Devizenko A. , Kalinin Yu , Lebedeva E., Shipkova I. , Sitnikov A., Syrev N. , Vysulin S. в журнале Solid State Phenomena , том 190, с. 605-608 . ...

Еще в разделе: (Показать все результаты (>4892) - istina.msu.ru/ )

• Vorobjev G.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Vysulin S. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Chekrygina Ju - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Главная -> Фильмы -> When Strangers Appear . ... Фильмы . ... When Strangers Appear . ... Австралия - США - Новая Зеландия 2001 . ... Когда перепуганный, истекающий кровью Мэтт входит в затерянное кафе, которым владеет Бет, там закручивается серия загадочных событий. ... Бет решает спасти Мэтта, но его последующее исчезновение и дальнейшее общение с гостями только еще больше запутывают ситуацию, и Бет все глубже и глубже погружается в пучину их опасных игр. ...

Еще в разделе: (Показать все результаты (>268) - kinfo.ru/ )

• Creature Feature: 50 Years o.. - Фильмы - Kinfo.ru
• Double Feature - Фильмы - Kinfo.ru
• Vertical Features Remake - Фильмы - Kinfo.ru

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>198) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Features of Proterozoic alkaline and subalkaline magmatism in Ukrainian shield: dependence on geodynamic position . ... The Late Proterozoic subalkaline and alkaline magmatism of Ukrainian shield has manifested itself approximately at the same time (1.9 – 1.7 milliard years ago) in different megablocks united with each other by suture zones. ... West Ingulets-Krivoi Rog and the Golovanevsko-Yadlovo-Traktemirov suture zones are sutures of that oceanic basin. ...

Еще в разделе: (Показать все результаты (>737) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Burnaeva.htm
• http://geo.web.ru/conf/alkaline/2009/Lapin1.htm
• Mineral Drawings site. Books,references,aesthetical genetic mineralogy

... K. Krylov . There was undertaken a research of lengthes of marinon - some integral units obtained by segmenting of comleted (whole) fiction prosaic texts (stories, small novels, novels). ... Overall corpus of considereded texts (Russian fiction prosaic) contain more than two million of graphic running words. Undertaken research has lead us to revealing of three main regularities. 1) to formulation of the law of optimum relation between number of elements within each submicroscopic level; . ...

Еще в разделе: (Показать все результаты (>57) - old.philol.msu.ru/ )

• MSU-LGCLL:: Anatoliy A.Polikarpov - Explaining Basic Menzerathian Regularity:
• MSU-LGCLL:: K