... Effect of mutations in the beta5-beta7 loop on the structure and properties of human small heat shock protein HSP22 (HspB8, H11). ... Because conservative Lys residues located in the beta5-beta7 loop and in the beta7 strand appear to play an important role in the structure and properties of HSP22, mutations in this part of the small heat shock protein molecule might have a deleterious effect and often correlate with the development of different congenital diseases. ...

Еще в разделе: (Показать все результаты (>87) - biochem.bio.msu.ru/ )

• Structure, properties, and functions of the human small heat-shock protein
• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of

Mailing List . Discussion club . Unresolved problems in the Study of Nature and Evolution of Human Language . ... Our goal is to consider some interesting and still unresolved problems of general theory of Human Language. ... Regularities of Human Language Evolution”. ... Universal, typological and stylistic features of Human Language Evolution; . ... Large Explanatory Dictionary of Russian (SPb: Norint, 1998. - 1536p.): preliminary evoluation of the dictionary (Russian letter "X") . ...

Еще в разделе: (Показать все результаты (>54) - old.philol.msu.ru/ )

• MSU-LGCLL:: Krylov J.K.- Three Laws of Fiction Prosaic Texts Organization
• MSU-LGCLL:: Anatoliy A. Polikarpov - Some Factors and Regularities of
• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>74) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• PDB entries containing domains of the family "RNA dependent RNA polymerase"
• PDB entries containing domains of the family "Ribbon-helix-helix protein, copG

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>54) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Analysis of change-point synchronization in multi-channel EEG
• Unsolved problems and new prospects

... 129 - 129I. 9 [1, 2]. 129Xe. . 1 1 ї тЫНУОНУ, ы.Д., 1996 "" - , - - . ... 244Pu? ... 136Xe, 134Xe, 132Xe. ... 130Xe 20 1 2 3 10 0 124 129 126 128 130 132 134 , 136 . ... тмдйгыдйЗ ы.Д. бЗЦбСзДь ихгъ З кмдДп 75 , , 107 Ag ( 107Ag 109Ag). ... 107 Ag / 109 Ag 53 Cr / 52Cr 10 4,0 5 0 60 200 000 400 000 108 Pd / 109Ag 26 0 Mg / 24Mg 0,155 0,150 0,4 55 0,8 Mn / 52Cr Ni / 58Ni 40 20 0,145 0,140 0,135 0 200 000 400 000 56 Fe / 58Ni 0 200 27 400 Al / 24Mg . ... 129Xe, 136Xe, 107Ag, 53Cr, 60Ni, 26Mg . ...

Еще в разделе: (Показать все результаты (>137) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/TristanDuPree.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>135) - www.genebee.msu.ru/ )

• Laboratory of protein-nucleic interactions (Russian version)
• Picornaviruses: discovering big in small

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Petrova G.P. , Petrusevich Y.M. , Perfil'eva I.A. , Ivanova M.S., Syaolei Chzhan . ... Petrova G.P. , Petrusevich Y.M. , Ten D.I. , Boiko A.V. , Fadyukova O.E. в журнале Proceedings - Society of Photo-Optical Instrumentation Engineers , издательство SPIE (Bellingham, WA, United States) , том 5147, с. 370-376 DOI . ...

Еще в разделе: (Показать все результаты (>1670) - istina.msu.ru/ )

• Marochkin D.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Lysachkov A.I. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Savelyev Evgenii N. - сотрудник | ИСТИНА - Интеллектуальная Система

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>157) - www.pereplet.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Some distributives (gentoo, openSuse, etc.) contains default Pymol љwithout vmd molfile plugins. ... Download pymol sources from sourceforge: pymol-1.4.1 . ... Open file setup.py and uncomment everything related to VMD molfile. ... Нет комментариев " Pymol compilation with VMD Molfile plugins " . ... Building and plotting Fukui function with FireFly and PyMol . Visualize partial charges in PyMol . ... 2013 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• Constructing discrete Laplacian via sparse matrix ERG Research Group:
• OPLS ERG Research Group: Лаборатория теоретической биофизики

... The lists of flora of Kem-Ludy archipelago (Russian White Sea, near Arctic Circle) produced in years 1962 and 2001-2004 were investigated by different methods of data analysis. The full species list contains 284 species. 27 islands were studied, four new islands were appeared due to the tectonic events. ... Most important factors are island square and openness (accessibility for winds). ... Marine birds are most important biological factor for island flora maintenance. ...

Еще в разделе: (Показать все результаты (>223) - herba.msu.ru/ )

• Behaviour of white water-lily flowers in different photoperiods
• The behavior of Nymphaea flowers
• The variability of different Drosera

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>17) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]

Antioxidant system of desiccation-tolerant insect Polypedilum vanderplanki Alexander A. Nesmelov1*, Elena I. Shagimardanova1, Maria D. Logacheva2, Richard Cornette3, Takahiro Kikawada3, Oleg A. Gusev 1 2 1,3,4,5 . ... Comparative analysis of genome and transcriptome of P. vanderplanki and congeneric desiccation-sensitive chironomid P. nubifer help us to reveal genes and proteins that ensure desiccation tolerance. ... Expression of analogous genes of P. nubifer during desiccation cycle does not change. ...

Еще в разделе: (Показать все результаты (>260) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/167.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/131.pdf

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>8) - margaret.imec.msu.ru/ )

• Scientific Achievements

... The analysis of bone assemblages from the Kudaro Paleolithic sites in Southern Ossetia provides a basis for identification of seven species of canids. The Middle Pleistocene fauna contains Canis arnensis kudarensis subsp. nov., ... Литература Скачать PDF . ... The modern-like fauna was formed during the Subatlantic. ... Phylogeography of the gray red-backed vole Craseomys rufocanus (Rodentia: Cricetidae) across the distribution range inferred from nonrecombining molecular markers . ...

Еще в разделе: (Показать все результаты (>1270) - zmmu.msu.ru/ )

• Epigenetic variation of the common shrew, Sorex araneus, in different habitats
• Biochemical analysis of the metabolism of small rodents living in different

56. (backlinks in System Web) GoBox < System < Foswiki

57. TemplateWeb < System < Foswiki

58. Undiscovered - Фильмы - Kinfo.ru

59. http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Shchepetov_Romanovsky_en.pdf

60. APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center