... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>18) - ferro.phys.msu.ru/ )

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>26) - smdc.sinp.msu.ru/ )

• IGRF10 model - Space monitoring data center
• Space monitoring data center

... Director of Economics and Finance . MINISTERY OF AGRICULTURE AND FOOD . ... phone: (++355) 42 24929 . fax: (++355) 42 27924 / 27920 . ... MINISTRY OF AGRICULTURE . ... MINISTRY OF AGRICULTURE AND FORESTRY . ... RESEARCH INSTITUTE OF AGRICULTURAL ECONOMY (RIAE) . ... Secretary General of National FAO Committee . ... Phone: (++3702) 61 45 25 Fax: (++3702) 61 45 24 . ... Phone/fax: (++0040 ) 1 7252201 (private) . ... 2) MINISTRY OF AGRICULTURE OF AGRICULTURE OF SLOVAK REPUBLIC . ...

Еще в разделе: (Показать все результаты (>156) - www.fadr.msu.ru/ )

• Working Groups
• NETWORK FOR AGRICULTURAL POLICY RESEARCH AND DEVELOPMENT

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>24) - eco.soil.msu.ru/ )

First Announcement Call for Papers THE CASPIAN REGION: ENVIRONMENTAL CONSEQUENCES OF THE CLIMATE CHANGE October 14-16, 2010 Moscow , Russia Organized by Faculty of Geography, M.V. Lomonosov Moscow State University INTRODUCTION The purpose of the Conference is to bring together researchers from different countries with experience in the Caspian area for exchange of data, results and ideas on environmental consequences of the climate ...

Еще в разделе: (Показать все результаты (>202) - www.geogr.msu.ru/ )

• High Point tech High Point tech (все сообщения)
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

You are here: Foswiki > System Web > JQueryPlugin > JQueryUITooltip (revision 1) E dit A ttach . ... Homepage: http://api.jqueryui.com/tooltip/ . ... To load the library into the current wiki page, add this somewhere on the page: %JQREQUIRE{"ui::tooltip"}% . This will initialize all DOM elements with a jqUITooltip css class and add a jQuery-ui tooltip to it. <a href="#" class="jqUITooltip" title="This is the tooltip content">hover me</a> . hover me . ... Name . ... Default . ... default . ...

Еще в разделе: (Показать все результаты (>2222) - wiki.cs.msu.ru/ )

• JQueryUIDialog < System < Foswiki
• UserDocumentationCategory < System < Foswiki
• SiteTools < System < Foswiki

VISA SUPPORT FORM |Family name| ... Date of | birth | __________________________________ If there is the second (or moreover) citizenship they are specified through a point State of birth ____________________ place of birth _______________________________________ country exact place of birth State of inhabitancy _________________ region___________________________________________ country region in the state of inhabitancy The closest Russian Consulate where you will ask for visa: ...

Еще в разделе: (Показать все результаты (>35) - foroff.phys.msu.ru/ )

• Выпускники 1968 A web page that points a browser to a different page after 5

AUTOMATED CREATION OF THE LUNAR HYPSOMETRIC MAP: TECHNIQUES OF COMPILING. ... And the second one is the database, obtained from the raster images of the Lunar Subpolar regions (higher than latitude ±60°) where brightness of each pixel depends on its height [1]. ... Due to these reasons it was necessary to develop the special 10-stage methodology of data processing and map compiling. ... The height data were obtained and the lunar hypsometric map was created according to the 10-stage methodology. ...

Еще в разделе: (Показать все результаты (>98) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Rod/Publications/ms34/MS060.pdf
• http://selena.sai.msu.ru/Shev/Publications/ms34/MS064.pdf

Pipe Line Filtering Dmitry V. Yurin Moscow State University, Faculty of Computational Mathematics and Cybernetics, Lab. of Mathematical Methods of Image Processing. yurin_d@inbox.ru Abstract A unified template C++ library is proposed for image filtering by local environment. ... It makes easy to combine filters and transfer output of filters to input of others. ... Otherwise, each filter one time should process input and output lines with the same relative numbers in the images. ...

Еще в разделе: (Показать все результаты (>511) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/Superres08.pdf
• View publication | Laboratory of Mathematical Methods of Image Processing

... Here is a brief outline of the current theory of the events in the early history of the solar system: . A cloud of interstellar gas and/or dust (the "solar nebula") is disturbed and collapses under its own gravity. ... The gas cools off enough for the metal, rock and (far enough from the forming star) ice to condense out into tiny particles. (i.e. some of the gas turns back into dust). ... Once the larger of these particles get big enough to have a nontrivial gravity, their growth accelerates. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

... Alignment Sequence . Include picture . No Picture Only Structure Structure and BP numbers Structure and Stem Energy Full Picture . Sequence name . Alignment OR sequence (without name). The usage of Alignment is strongly recommended. Alignment example: . ... ANMF CGCGGGGTAGAGCAGCCTGGTAGCTCGTCGGGCTCATA AQTRNF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAA BGTRF GCC-AGGATAGCTCAGTTGGTAGAGCAGAGGACTGAAT ANMF ATCCTCTCCCCGCC---- AQTRNF ATCCGCCTCCCGGCACCA BGTRF ATCCGCCTCCCGGCACCA . ...

Еще в разделе: (Показать все результаты (>169) - www.genebee.msu.ru/ )

• Screening pattern or alignmemt against PROTEIN databank
• screening by keywords
• Screening by similarity

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>23) - cdfe.sinp.msu.ru/ )

• CDFE provides the major photonuclear databases. Online Services.
• CDFE => Online Services => Nucleus Ground State Parameters

INVOLUTION DIFFEOMORPHIC OF MANIFOLDS TO REAL WITH A SET PROJECTIVE OF FIXED POINTS SPACE UDC 517.83 A. S. Mishchenko It is proved that if, on a manifold with an involution, the subset of fixed points is diffeomorphic to an even-dimensional real projective space, then the manifold is bordant to the complex projective space in the class of nonoriented bordisms. ... For each manifold Mn, there is a manifold with involution N 2n such that Mn is its set of fixed points. ...

Еще в разделе: (Показать все результаты (>172) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/garber/talks/2010Texas.pdf
• http://higeom.math.msu.su/people/taras/papers/9910083.ps
• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1969/Functional%20Analysis%20and%20Its%20Applications/Quadratic%20forms%20over%20commutative%20group%20rings%20and%20the%20K-theory.pdf

HUMANITARIAN ASPECTS OF TEACHING MATHEMATICS IN HIGHER SCHOOL Positselskaya L.N. (Moscow) There are considered goals of survey course on mathematics in higher school, its role in building up the scientific world outlook. It is pointed out the importance of analyzing of interdisciplinary connections of mathematics with other branches of knowledge. There is proposed general approach to programs f survey courses on mathematics for different specialities. ... 10, 2002, .137-139 , . ... 1.1 . ...

Еще в разделе: (Показать все результаты (>192) - www.mce.biophys.msu.ru/ )

• Books : Microsoft Office Power Point 2007. Шаг за шагом + приложение

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>13) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt1_Color_photo.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>7) - tex.bog.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... INT_MIN / -1 = Floating point exception . ... Re: INT_MIN / -1 = Floating point exception [ re: Spin ] . ... Re: INT_MIN / -1 = Floating point exception [ re: Basilio ] . ...

Еще в разделе: (Показать все результаты (>5378) - www.fds-net.ru/ )

• [fortran] вопрос знатокам - Public forum of MSU united student networks
• Dead Horse Point - Public forum of MSU united student networks
• Vantage Point (точка обстрела). я посмотрел, а вы? - Public forum of MSU united