... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. Anisotropy effects investigations by resistivity method in some inhomogeneous media. ... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. The new approach to the analysis of the azimuthal resistivity data over anisotropic media. ... Bolshakov D.K., Modin I.N., Pervago E.V., Shevnin V.A. Modeling and interpretation of azimuthal resistivity sounding over two-layered model with arbitrary - oriented anisotropy in each layer.. ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• Anis. Page2
• TES. Median algorithm
• Page 3. Publications

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>35) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• ETS numeration assumed
• About this project

log . ... Wed, 16 Mar 2011 21:34:06 +0300 . boris (kodomo) . ... Fri, 04 Mar 2011 15:16:28 +0300 . ... Daniil Alexeyevsky . Automated merge with ssh://kodomo/allpy . Mon, 28 Feb 2011 22:40:16 +0300 . ... Tue, 01 Mar 2011 00:17:13 +0300 . boris . ... Sat, 26 Feb 2011 18:59:48 +0300 . ... Sun, 27 Feb 2011 23:49:54 +0300 . ... Fri, 25 Feb 2011 18:00:20 +0300 . ... Thu, 24 Feb 2011 23:51:52 +0300 . ... Wed, 23 Feb 2011 23:10:47 +0300 . ... Tue, 22 Feb 2011 23:00:34 +0300 . ...

Еще в разделе: (Показать все результаты (>5426) - kodomo.fbb.msu.ru/ )

• snake: 3619305694ad snake.py
• snake: snake.py annotate
• snake: log

... Department of Vertebrate Zoology . ... In 1808 the Chair of Zoology and Botany was subdivided into two independent departments and later a Chair of Anatomy was founded by professor D. I. Dvigubsky. ... However in 1878 he was the head of Zoological Department too. ... In the reports of these years one can find not only the Vertebrate Zoology and Comparative Anatomy Departments but also the Departments of Fur Trade Zoology, of Morphology and of Vertebrate Systematics. associate professor E.S.Ptushenko...

Еще в разделе: (Показать все результаты (>64) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>17) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>178) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• shuvalov_dept

... Alexey Garber Moscow State University April 17, 2010 A. Garb er (MSU) Quasicrystals April 17, 2010 1 / 33 Ё This work is a joint work with Dirk Frettloh from Bielefeld University. A. Garb er (MSU) Quasicrystals April 17, 2010 2 / 33 Separated net Definition A subset A of metric space M is called separated net if for some constants r and R following condition holds: for every two points x1 , x2 A distance dM (x1 , x2 ) r and for every point y M dM (y , A) R . ...

Еще в разделе: (Показать все результаты (>91) - higeom.math.msu.su/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD Dmitry N. Dirin . ... Cadmium chalcogenide colloidal quantum dots (semiconductor nanocrystals). Electronic and optical properties of quantum dots. ... Semiconductor nanoheterostructures. ... Grant UMNIK-2008 "Development of prototype of the solar cell photosensitive element based on CdTe/CdSe colloidal quantum dots". ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>37) - www.lssm.inorg.chem.msu.ru/ )

... New carriers in sorption-catalytic analysis . ... Search for and molecular design of metallated and organoelement receptors for the rcovery and determination of organic compounds . ... Electrokinetic ion chromatography - novel method for separation and determination of simple and complex cations and anions . ... Development of the principles of analytical methods of separation and preconcentration and use of these methods in environmental analysis . ... Novel ion-exchange HPLC materials . ...

Еще в разделе: (Показать все результаты (>29) - analyt.chem.msu.ru/ )

Backlinks to WikiGroups in all Webs ( Search Main Web only ) . ... Administrator Group * Member list (comma separated list): * Set GROUP = RomanKondakov * Persons/group who can change the list: * Set ALLOWTOPICCHANGE ... r2 - 22 Aug 2009 - 23:36 by AdminUser . ... NEW - 09 Jan 2009 - 12:00 by ProjectContributor . ... GroupViewTemplate . ... PracticumVGroup * Member list (comma separated list): * Set GROUP = Main.RomanKondakov Main.МихаилВасильевич * Persons/group who can change the list: .. ...

Еще в разделе: (Показать все результаты (>1604) - wiki.cs.msu.ru/ )

• (backlinks in Main Web) WikiGroups < Main < Foswiki
• (backlinks in System Web) VarWIKINAME < System < Foswiki
• (backlinks in Main Web) DontsovEvgeny < Main < Foswiki

Microsymposium 38, MS080, 2003 (A4 format) PHYSICAL AND MINERALOGY CHARACTERISTICS OF THE LUNAR REGOLITH IN THE AREAS OF THE THERMAL ANOMALIES. ... Comparison of the local cumulative number of particles N per 104 m2 and photometric roughness parameter I. In this report we research data of the IR thermal radiation, the rough structure of the lunar regolith and mineralogy characteristics upper layer of the surface. ... The spatial graphical function of the lunar-surface thermal radiation. ... Figure 3. ...

Еще в разделе: (Показать все результаты (>78) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/San/Publications/ms34/MS047.pdf
• http://selena.sai.msu.ru/Pug/Publications/ms34/MS058.pdf

... Kaplanb, Hovagim Bakardjiana, 4 Andrzej Cichockia 5 Laboratory for Advanced Brain Signal Processing, RIKEN Brain Science Institute, 2-1 Hirosawa, Wako-shi, Saitama 351-0198, Japan b Department of Human and Animal Physiology, Faculty of Biology, Moscow State University, Russia a PROOF Combining the extremities on the basis of separation: 2 a new approach to EEG/ERP source localization 3 6 7 8 UNCORRECTED Abstract. ... The localization algorithm can be then applied to each of the separated sources. ...

Еще в разделе: (Показать все результаты (>65) - brain.bio.msu.ru/ )

• Unsolved problems and new prospects
• Change-point detection algorithm performance with real EEG

... Moskovsky Alexander . ... Rogov Alexander . Modeling the reaction of hydrolysis of peptide bonds by trypsin by using quntum mechanical - molecular mechanical methods . ... Title: "Modeling Spectra of Molecular Clusters by Quantum Chemistry and Molecular Dynamics Methods" . ... Title: "Development of the Combined Quantum Mechanical - Molecular Mechanical Methods" . ... Title: "Modeling mechanisms of enzymatic hydrolysis reactions by the combined quantum mechanical - molecular mechanical methods" . ...

Еще в разделе: (Показать все результаты (>4) - lcc.chem.msu.ru/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>2) - physcontrol.phys.msu.ru/ )

• List All Categories

INTEGRATED SYSTEM FOR TREATMENT OF LIQUID MANURE STREAMS FOCUSED ON MAXIMISATION OF PRODUCTION OF VALUABLE BY-PRODUCTS (FERTILISERS, BIOGAS) AND RE-UTILISATION OF WATER . Proposed scheme of liquid manure treatment : . ... F - physico-chemical removal of nutrients: struvite (MgNH 4 PO 4 ) & hydroxyapatite (Ca 5 (PO 4 ) 3 OH) . ... SHP - struvite & hydroxyapatite precipitation Z -zeolite; . AL - airlift . ... Solid phosphorous fertiliser (mixture struvite & hydroxyapatite) . ...

Еще в разделе: (Показать все результаты (>139) - www.enzyme.chem.msu.ru/ )

... Find the second-quantized expression for the field operator (x) of a massless scalar field in a compact spatial domain x D, in terms of the eigenfunctions of (- 2 ) in D. Find the second-quantized expression for the Hamiltonian of in this domain. ... Find the Casimir energy using the exponential smooth cutoff + explicit renormalization for a massless scalar field in D = 1 + 1. ... Find the Fourier image g (z , z ; , k ) of the Green function for a massless scalar field for z , z < 0. ...

Еще в разделе: (Показать все результаты (>3) - theorphys.phys.msu.ru/ )

Legendre singularities and implicit ODE Vladimir Zakalyukin Moscow State University, Moscow, 119991, Russia e-mail: zak@k804.mainet.msk.su The classification of singularities of first order implicit differential equations in one variable due to A.Poincare, M.Chibrario, V.Arnold, J.W.Bruce, A. Davydov, and others is a famous application of singularity theory. ... A version of the notion of an implicit equation called web is of interest in physics and geometry. ...

Еще в разделе: (Показать все результаты (>12) - pont2008.cmc.msu.ru/ )

... Home . ... Faculty . ... Your email * . ... Send to * . ... CMC MSU students at GSIS Summer School, Tohoku University, Japan . ... Second CMC MSU ? GSIS Tohoku Joint IT Seminar . ... CMC MSU ? ... Delegation from Tohoku University (Japan) at CMC MSU . ... The Faculty Site is in the adjustment state. Any comments on the contents and functioning of the site should be addressed to cmcproject@cs.msu.ru . 1996?2016 ї Faculty CMC Lomonosov Moscow State University . ... About this site . ...

Еще в разделе: (Показать все результаты (>144) - en.cs.msu.ru/ )

... Work of a system constructing the exercises with the help of a teacher is described. Algorithms of fragmentation of sound data into phonemes and of analysis of correctness of pronunciation of a student are suggested. ... The authors offer the functioning variant of a system, making it possible to a student to appreciate objectively a degree of correctness of his pronunciation, to classify errors and to listen to a difference of pronunciations of incorrect sounds interactively. ...

Еще в разделе: (Показать все результаты (>53) - www.intsys.msu.ru/ )

• Installation

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... как установить Qip на комуникатор? ... Re: как установить Qip на комуникатор? [ re: montanaro ] . ... qip.ru . ... Re: как установить Qip на комуникатор? [ re: ain_soph ] . ...

Еще в разделе: (Показать все результаты (>428) - www.fds-net.ru/ )

• Принтер посоветуйте плз - Public forum of MSU united student networks
• Есть Pimsleur - Public forum of MSU united student networks
• Закрыто - Public forum of MSU united student networks