... Home . ... Faculty . ... Your email * . ... Send to * . ... CMC MSU students at GSIS Summer School, Tohoku University, Japan . ... Second CMC MSU тИТ GSIS Tohoku Joint IT Seminar . ... CMC MSU тИТ GSIS Tohoku IT Joint Seminar . ... Delegation from Tohoku University (Japan) at CMC MSU . ... Invited lecture by Prof. Vijay Ganesh (University of Waterloo, Ontario, Canada) . The Faculty Site is in the adjustment state. ... 1996тАУ2016 €й Faculty CMC Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>163) - en.cs.msu.ru/ )

... Living systems depository "Noah's Ark" . ... About the project . ... The project of the Moscow State University "Noah's Ark" is dedicated to the creation of multi-functional network storage of biological material. ... Creation of temporary prototypes of living systems depository bank for storage and research of the collected material. ... Development of algorithms for the information processes analysis in living systems for receiving, filing and processing of various types of biological data. ...

Еще в разделе: (Показать все результаты (>5) - depository.msu.ru/ )

... Previous message: [Comphep-common] transverse mass . Next message: [Comphep-common] forward-backward asymmetry . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... I found there is a new function for mixing separate event files. But when I was trying to make table from the mixed event file, no useful result can be produced. I'm wondering is that because the mk_tab program can only recognize separate event file or is there any hidden function I didn't find? ...

Еще в разделе: (Показать все результаты (>613) - theory.sinp.msu.ru/ )

• [Comphep-common] comphep error
• Stratified sampling
• [Comphep-common] Polarization of outgoing particles

... Совместное обитание в Турции подтверждает видовые статусы Miniopterus schreibersii schreibersii и M. schreibersii pallidus (Mammalia: Chiroptera) // Syntopic occurrence in Turkey supports separate species status for Miniopterus schreibersii schreibersii and M. schreibersii pallidus (Mammalia: Chiroptera). ... Two subspecies previously recognized in Turkey, M. s. schreibersii and M. s. pallidus , differ significantly in nuclear and mitochondrial DNA, and in morphology. ...

Еще в разделе: (Показать все результаты (>889) - zmmu.msu.ru/ )

• Bird collections
• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Murina - Tube-nosed bats

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . The GDE alignment format is one of the standard alignment formats. Popular programs for sequence alignment, e.g. ClustalW, can save alignment in this format. ... Sequences are placed one after another, the name of each sequence is placed onto a separate line and begins with ‘%’. ... Thus the alignment looks like this: . ... back to input format rules . ...

Еще в разделе: (Показать все результаты (>32) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• ETS numeration assumed
• About authors ot this complex

INTEGRATED SYSTEM FOR TREATMENT OF LIQUID MANURE STREAMS FOCUSED ON MAXIMISATION OF PRODUCTION OF VALUABLE BY-PRODUCTS (FERTILISERS, BIOGAS) AND RE-UTILISATION OF WATER . Proposed scheme of liquid manure treatment : . ... F - physico-chemical removal of nutrients: struvite (MgNH 4 PO 4 ) & hydroxyapatite (Ca 5 (PO 4 ) 3 OH) . ... SHP - struvite & hydroxyapatite precipitation Z -zeolite; . AL - airlift . ... Solid phosphorous fertiliser (mixture struvite & hydroxyapatite) . ...

Еще в разделе: (Показать все результаты (>118) - www.enzyme.chem.msu.ru/ )

... Up: MPI and Threads Next: Clarifications Previous: MPI and Threads . In a thread-compliant implementation, an MPI process is a process that may be multi-threaded. ... MPI implementations where MPI `processes' are POSIX threads inside a single POSIX process are not thread-compliant by this definition (indeed, their ``processes'' are single-threaded). ... A blocked thread will not prevent progress of other runnable threads on the same process, and will not prevent them from executing MPI calls. ...

Еще в разделе: (Показать все результаты (>256) - www.parallel.ru/ )

• Automatic generation of profiling libraries | PARALLEL.RU -
• Portable MPI Process Startup | PARALLEL.RU - Информационно-аналитический центр
• Version Number | PARALLEL.RU - Информационно-аналитический центр по

... fseqboot all.fasta -auto fdnaml CONSENSUS TREE: the numbers on the branches indicate the number of times the partition of the species into the two sets which are separated by that branch occurred among the trees, out of 100.00 trees +------E +-87.0-| ... Консенсусное дерево неукорененное. ... A Sets included in the consensus tree Set (species in order) How many times out of 100.00 .* ... 55.00 Sets NOT included in consensus tree: Set (species in order) How many times out of 100.00 .* ...

Еще в разделе: (Показать все результаты (>786) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad тАУ Python Battle
• main.py тАУ Python Battle
• Changeset 102:a308291203ea тАУ Cyclyc Cell Automata

... Alders ( Alnus Mill.) are the common trees in Europe and Asia, and there are some taxonomically interesting forms on the border of the area. ... We have checked mentioned hypotheses using multivariate methods based on classic morphometrics data and two variants of geometric morphometrics of alder leaf. ... On the contrary, A. barbata must be considered as separate species. Our data show that the results of geometric morphometrics and classic morphometrics could be significantly different. ...

Еще в разделе: (Показать все результаты (>169) - herba.msu.ru/ )

• Haptanthus
• Morphological differences of Nymphaea alba L

log . ... Wed, 16 Mar 2011 21:34:06 +0300 . boris (kodomo) . ... Fri, 04 Mar 2011 15:16:28 +0300 . ... Daniil Alexeyevsky . Automated merge with ssh://kodomo/allpy . Mon, 28 Feb 2011 22:40:16 +0300 . ... Tue, 01 Mar 2011 00:17:13 +0300 . boris . ... Sat, 26 Feb 2011 18:59:48 +0300 . ... Sun, 27 Feb 2011 23:49:54 +0300 . ... Fri, 25 Feb 2011 18:00:20 +0300 . ... Thu, 24 Feb 2011 23:51:52 +0300 . ... Wed, 23 Feb 2011 23:10:47 +0300 . ... Tue, 22 Feb 2011 23:00:34 +0300 . ...

Еще в разделе: (Показать все результаты (>4546) - kodomo.fbb.msu.ru/ )

• snake: 3619305694ad snake.py
• snake: snake.py annotate
• snake: log

Kinetics of redox reactions of Pu(V) in solutions containing different fractions of humic substances O.A. Blinova*, A.P. Novikov, I.V. Perminova+, R.G. Haire *A.N.Frumkin Institute of Physical Chemistry and Electrochemistry, Moscow , Russia , Vernadsky Institute of Geochemistry and Analytical Chemistry, Moscow , Russia , + Lomonosov Moscow State Univercity, Moscow , Russia , Oak Ridge National Laboratory Humic ...

Еще в разделе: (Показать все результаты (>141) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2010/2010-kulikova-a-comparative.pdf
• MGUMUS -- Philippe Schmitt-Kopplin

... Полная версия этой страницы: Barclays Capital 2009 . Студенческий форум Физфака МГУ > Общий > Работа . ... 19.8.2009, 14:08 . Barclays Capital is the investment banking division of Barclays Bank PLC, offering strategic advisory, financing and risk management solutions to large corporate, government and institutional clients. ... To register for the event, please apply online at www.barcap.com/expectexcellence and select 'Moscow' as the location in your application. ...

Еще в разделе: (Показать все результаты (>1614) - wasp.phys.msu.ru/ )

• Barclays Capital 2009 - Студенческий форум Физфака МГУ

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Catering POS Solution Time for Put The ?F . ... Similarly, appearances in this media or in relation to dedicated cookery episodes can be a strong indicator of which you are deciding on the same gourmet meat that very top <strong><a href="http://forum.amariha.ir/entry.php?44208-Event-caterers -From-A-Nachos-Restaurant-For-A-single-Birthday">casual restaurants</a></strong>s are searching too. ...

Еще в разделе: (Показать все результаты (>2918) - www.sevin.ru/ )

• Laboratories: Laboratory for Biodiversity Concervancy and Bioresources Use:
• Laboratories: Laboratory for behavior and behavior ecology of mammals: Goals
• Laboratories: Laboratory for Soil Zoology and General Entomology: Goals and

... Separation of all runs on several groups by mean active sectors. ... Ways to carry out step 2: trying to cut off all points which don't reach the fit line with errors. Ways to carry out step 2: mean active sectors selection Ways to carry out step 2: results of mean active sectors selection by example of set 2 Failing of mean active sector selection method on example of set 3: one point is still on the graph Introduction of new distance parameter How to find an optimal distance parameter? ...

Еще в разделе: (Показать все результаты (>10) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

TITLE OF THE ABSTRACT FIRST I. AUTHOR1, SECOND I.J. AUTHOR2 AND THIRD AUTHOR2 1Organization name of the first author first_ author@email.ru 2Organization name of the second and third authors second.author@email.com, third_author@mail.eu Key words: list up to eight words or group of words in order of priority, separated by commas. ... The abstract including figures, tables and reference should not exceed 1 page. The title should be centered in the page, in 11pt, boldface Roman, all capital letters. ...

Еще в разделе: (Показать все результаты (>35) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/Yakhot-abstract.doc
• http://hit-conf.imec.msu.ru/2012/lectures/index.html

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>134) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced

... Alexey Garber Moscow State University April 17, 2010 A. Garb er (MSU) Quasicrystals April 17, 2010 1 / 33 Ё This work is a joint work with Dirk Frettloh from Bielefeld University. A. Garb er (MSU) Quasicrystals April 17, 2010 2 / 33 Separated net Definition A subset A of metric space M is called separated net if for some constants r and R following condition holds: for every two points x1 , x2 A distance dM (x1 , x2 ) r and for every point y M dM (y , A) R . ...

Еще в разделе: (Показать все результаты (>110) - higeom.math.msu.su/ )

... Company Presentation, Workshops & Evening Reception Wednesday 30th September 2009, 14:30 - 19:30 Sheraton Palace Hotel Moscow, Rooms St.Petersburg 1-2 The presentation will give you an insight in our business model, our culture. Workshops will provide you with information on how to apply for full-time positions and internships. ... To register for the event, please apply online at www.barcap.com/expectexcellence and select "Moscow" as the location in your application. ...

Еще в разделе: (Показать все результаты (>81) - www.msu.ru/ )

• http://www.msu.ru/int/niokr/bio/zoology.doc

... Department of Vertebrate Zoology . ... In 1808 the Chair of Zoology and Botany was subdivided into two independent departments and later a Chair of Anatomy was founded by professor D. I. Dvigubsky. ... However in 1878 he was the head of Zoological Department too. ... In the reports of these years one can find not only the Vertebrate Zoology and Comparative Anatomy Departments but also the Departments of Fur Trade Zoology, of Morphology and of Vertebrate Systematics. associate professor E.S.Ptushenko...

Еще в разделе: (Показать все результаты (>80) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

Backlinks to WikiGroups in all Webs ( Search Main Web only ) . ... Administrator Group * Member list (comma separated list): * Set GROUP = RomanKondakov * Persons/group who can change the list: * Set ALLOWTOPICCHANGE ... r2 - 22 Aug 2009 - 23:36 by AdminUser . ... NEW - 09 Jan 2009 - 12:00 by ProjectContributor . ... GroupViewTemplate . ... PracticumVGroup * Member list (comma separated list): * Set GROUP = Main.RomanKondakov Main.МихаилВасильевич * Persons/group who can change the list: .. ...

Еще в разделе: (Показать все результаты (>1674) - wiki.cs.msu.ru/ )

• (backlinks in Main Web) WikiGroups < Main < Foswiki
• (backlinks in System Web) VarWIKINAME < System < Foswiki
• (backlinks in Main Web) DontsovEvgeny < Main < Foswiki