... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>6409) - hist.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>729) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Keldysh Institute of Applied Mathematics of RAS . DRIVER: 3D numerical modelling of high energy density plasma physics . ... AREA: Plasma Physics . ... IMPACT: The expected results of numerical experiments will help to explain the observed statistical characteristics of molecular hydrogen clouds in external galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>34) - hpc.msu.ru/ )

• APPLICATIONS: Astronomy | Moscow University Supercomputing Center

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>50) - sn.sai.msu.ru/ )

International Symposium Quasifission Process in Heavy Ion Reactions Messina (Italy) November 8-9, 2010 First Circular Chairman : Giorgio Giardina ( Messina ) Co-Chairman: Avazbek Nasirov (Dubna) Co-Chairman: Sara Pirrone (Catania) Scientific Secretary: Giuseppe Mandaglio ( Messina ), and Alessia Di Pietro (Catania) Local Organizing Committee: Giovanni Fazio ( Messina ), Giorgio Giardina ( Messina ), Giuseppe Mandaglio ( Messina ), Marina Manganaro ( ...

Еще в разделе: (Показать все результаты (>160) - phys.msu.ru/ )

• Публикации по истории факультета
• Задачи вступительных экзаменов

... Thursday, August 22, 2002 аа ORAL SESSION . ... Hamilton M. Acoustic Streaming in a Cylindrical Tube . ... Boudlal A. Nonlinear Stability of Roll Waves . ... Interaction of Acoustic and Temperature Fields in Thermoacoustics . ... Sugimoto N. Effects of Spatially Periodic Temperature Distribution on Amplification of Energy Flux of a Nonlinear Acoustic Pulse Propagating in a Gas-Filled Tube . ... Shugaev F. The Role of Acoustic Radiation During the Interaction of a Shock Wave with a Turbulent Flow . ...

Еще в разделе: (Показать все результаты (>178) - acs366.phys.msu.su/ )

• ISNA-16
• Abstract

... Publications . ... Cosmic rays of extremely high energy . ... M.I. Panasyuk. ... B.A. Khrenov. ... M.I. Panasyuk and B.A. Khrenov. Envoys of space: far or near? Ultrahigh energy cosmic rays. ... Cosmic rays of the highest energy ? ... Space Program KOSMOTEPETL (Projects KLYPVE and TUS ) for the Study of Extremely High Energy Cosmic Rays. ... KLYPVE/TUS space experiment for study of the ultrahigh energy cosmic rays.љ ... Space Detector TUS for Extreme Energy Cosmic Rays Study. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• News | Университетский спутник "Ломоносов"
• Cosmic rays of extremely high energy | Университетский спутник "Ломоносов"
• DEPRON | Университетский спутник "Ломоносов"

... Seminar archive . ... Seminar archive 2012 22 June . ... Гнедин О. Ю. Numerical simulations of galaxy formation, based on the cold dark matter model, explain the observed large-scale structure and abundance of massive galaxies. ... Many more dwarf galaxies around large galaxies are predicted than observed, leading to the "missing satellites problem". Much more cosmic gas inside galaxy halos is predicted than observed, leading to the "missing baryons problem". ... All seminars: . ...

Еще в разделе: (Показать все результаты (>223) - master.sai.msu.ru/ )

• SAI Space Monitoring Laboratory

... International Conference Advanced Carbon Nanostructures (ACNS'2015), June 29 - July 3, 2015, St. Petersburg, Russia. ... March 20, 2012, Moscow, Russia. ... IX International Conference Atomic and Molecular Pulsed Lasers, September 14th-18th, 2009, Tomsk, Russia. 21st Colloquium on High Resolution Molecular Spectroscopy, August 31st-September 4th 2009, Castellammare di Stabia, Italy. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>45) - rswater.phys.msu.ru/ )

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• Best search engines for finding scientific information in the Internet:

... The experimental data obtained using Cherenkov light of EAS reflected from the snow surface of the Big Alma-Ata Lake (Kazakhstan) are presented. ... The balloon-borne measurements in the energy range 10 15 -10 20 eV are planned. ... SPHERE detector array was elaborated for balloon-borne experiment [3-5]. ... SPHERE detector was situated on the 160 m high mountain ledge nearby the B.Alma-Ata lake (2500 m above sea level) to detect Cherenkov light reflected from the snow surface of the lake. ...

Еще в разделе: (Показать все результаты (>2) - sphere.sinp.msu.ru/ )

... Scientific Effort . ... Cosmic ray astrophysics . Space Physics . ... Nuclear physics . ... The paper was prepared with contributions from Elena Popova from the Skobeltsyn Institute of Nuclear Physics (Lomonosov Moscow State University) and was published in Scientific Reports. ... Federal State Budget Educational Institution of Higher Education M.V.Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics (SINP MSU), 1(2), Leninskie gory, GSP-1, Moscow 119991, Russian Federation . ...

Еще в разделе: (Показать все результаты (>6) - sinp.msu.ru/ )

The Energy Spectrum of Primary Cosmic Rays by the Data of Tunka Cherenkov Array . S.V.Bryanski, Y.V.Vasilchenko, O.A.Gress, T.I.Gress, G.N.Dudkin, A.I.Klimov, V.S.Khlytchieva, L.A.Kuzmichev, B.K.Lubsandorzhiev, E.A.Osipova, V.N.Padalko, L.V.Pan'kov, Yu.A.Parfenov, P.G.Pochil, V.V.Prosin, Yu.A.Semeney . Proc. 24th ICRC, Roma, 1995, v.2, p.724 . The First Results of TUNKA-13 EAS Cherenkov Light Experiment . ... Tunka EAS Cherenkov Array - status 2001 . ... 1) SINP MSU, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>18) - dbserv.sinp.msu.ru/ )

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>273) - ee-journal.spa.msu.ru/ )

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>27) - site2010.sai.msu.ru/ )

• Observatories

Silk companion icon set #1 - "More Silk!" Last updated: 19 November 2007 _________________________________________ Damien Guard http://www.damieng.com/icons/silkcompanion _________________________________________ This work is licensed under a Creative Commons Attribution 2.5 License. [ http://creativecommons.org/licenses/by/2.5/ ] The FamFamFam Silk icon set is a very large, consistent set of well-drawn icons that has proven to be popular with both applications and web sites. ...

Еще в разделе: (Показать все результаты (>3924) - wiki.cmc.msu.ru/ )

• WebHome < System < Foswiki
• TipTopic009 < System < Foswiki
• JSCalendarContribInline < System < Foswiki

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>69) - fgp.msu.ru/ )

... Field of research: Extragalactic astronomy. ... NASA Astrophysics Data System (ADS) Abstract Service . ... CADC Home Page . ... CCD Images of Galaxies . ... RUSSIAN LINKS . ... UA Astronomy Personal Home Page - Bill Keel . ... The Shape of the Rotation Curves of Edge-on Galaxies, by A.V.Zasov and A.V.Khoperskov, 2003. ... A Thickness of Stellar Discs, by A.V.Zasov, and D.V.Bizyaev, 2003 . Minimum Velocity Dispersion in Stable Stellar Disks, by A.V.Khoperskov, A.V.Zasov, and N.V.Tyurina, 2003 . ...

Еще в разделе: (Показать все результаты (>59) - neptun.sai.msu.ru/ )

• Apache Server Virtual Host Support

The Department of Talented Youth Affairs and Professional Orientation . ... Projects . ... From 1 to 6 July 2014 there were held the third championship of the ?SanSat in Russia? which took place in Dubna (Moscow) ? ... CanSat is a model of microsatellite weighing about 350 grams. CanSat project started in 1999. ... Participants at the third championship were offered a large educational and excursion programs. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>58) - talant.msu.ru/ )

• admin | The Department of Talented Youth Affairs and Professional Orientation |
• Methods of Working with Talented Students at the Moscow State University | The

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>37) - ferro.phys.msu.ru/ )