День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>3) - www.dubinushka.ru/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>1991) - istina.msu.ru/ )

• M?gi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kr?l M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>32) - eco.soil.msu.ru/ )

• THEORETICAL PRINCIPLES AND METHODS OF REMEDIATION OF SOILS POLLUTED WITH HEAVY

Permitted Context: %text . ... The <IMG> tag is used to incorporate in-line graphics (typically icons or small graphics) into an HTML document. This element is NOT intended for embedding other HTML text. ... Browsers that cannot display in-line images ignore the IMG element unless it contains the ALT attribute. ... Take values TOP or MIDDLE or BOTTOM, defining whether the top or middle or bottom of the graphic should be aligned with the baseline for the text line in which the IMG element appears. ...

Еще в разделе: (Показать все результаты (>150) - comet.sai.msu.ru/ )

• Figure Overlays
• Welcome to Astronomical Circular
• Previous and Proposed

... Influence of Cavitation and Thermoacoustic Processes on Biological Tissue Destruction Under Action of Laser Pulses with Regular Temporal Structure . ... One can suppose that proper temporal structure of laser pulses allows to increase the efficiency of heat removal due to speeding-up of tissue removal and to reduce the area of thermal injury. ... The energy and temporal structure of pulses, and acoustic wave generated by radiation in the tissue were controlled. ...

Еще в разделе: (Показать все результаты (>106) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
• ISNA-16

PHP Manual . Prev . ... Next . To the best of our knowledge, the first article about PHP in a hard-copy magazine was published in the French Informatiques Magazine, towards the end of 1998, and covered PHP 3.0. As with books, this was the first in a series of many articles published about PHP in various prominent magazines. Articles about PHP appeared in Dr. Dobbs, Linux Enterprise, Linux Magazine and many more. ... Books about PHP . ... Using PHP from the command line ...

Еще в разделе: (Показать все результаты (>238) - oit.cmc.msu.ru/ )

• Common Pitfalls
• pg_locreate
• PostgreSQL functions

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3308) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>2151) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... This paper argues that a mixed system of private and state universities seems the best structure to secure dynamism, accessability, and efficiency of higher education insitutions in post-industrial societies. ... Whereas the university system of Germany is to a large degree state-operated, the British system combines some elements of private higher education with an also largely state-operated university system. ... The United States would seem to provide the best structure for a university system. ...

Еще в разделе: (Показать все результаты (>132) - www.prof.msu.ru/ )

• Commemoration of the centenary of Senator Fulbright's birth
• RUSSIA UNDER PUTIN

... Home > Department of Algorithmic Languages . Head of the department: Mikhail G. Malkovskiy, Professor, Dr.Sc. ... Vladimir G. Abramov, Associate Professor, PhD, Scientific Secretary of the Department . ... Algorithms and Algorithmic Languages by Prof. Solovyev, 54 lecture hours and 72 seminar hours, 1st semester. ... Prof. Bordachenkova, 48 lecture hours and 64 seminar hours, 2nd semester. ... Prof. Volkova and Dr. Vylitok, 46 lecture hours and 60 seminar hours, 4th semester. ... Prof. Abramov. ...

Еще в разделе: (Показать все результаты (>119) - en.cs.msu.ru/ )

• Department of Algorithmic Languages | CMC MSU

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>14) - www.ecocoop.ru/ )

Storing and accessing the largest astronomical catalogues with the SAI CAS project S. Koposov1,2,3, O. Bartunov2, S. Karpov4 et al2. ... Why we want to build our own Catalogue Access Service The requirements for our CAS system The importance of the Database for the CAS (PostgreSQL & Q3C) The technical realization of CAS What has been already done Example of work TODO Storing and Accessing Astronomical Catalogues Existing projects CDS OpenSkyQuery CASjobs with SDSS They are all really great! ...

Еще в разделе: (Показать все результаты (>500) - lnfm1.sai.msu.ru/ )

• Works and publications by Leonid Zotov Works and publications by Leonid Zotov
• Data bases of Natural Satellites. Documentation. Structure
• jo1002

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>74) - srcc.msu.ru/ )

• Differential equations in Banach space and it's approximation.
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>85) - fgp.msu.ru/ )

05 Nov 2003 The Sun has continued its recent high levels of activity. At 1950 UT, 4 November 2003, a class X28 solar flare was released by the Sun. ... LASCO C2 Images of X28 Flare at 1950UT 04/11/2003 . ... SOHO (Solar and Heliospheric Observatory) is located between the Sun and the Earth and will, therefore, detect activity before it reaches the Earth. ... All this ongoing solar activity means that the Earth is destined to be bathed in more radiation - generating further auroral displays. ...

Еще в разделе: (Показать все результаты (>185) - www.kosmofizika.ru/ )

• July 15, 2000 North American view Animation
• L.Lazutin, List of publications

... Publications . Activities . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Publication type . Conference paper . ... Publication date . August 2010 . Conference . Proceedings of International Conference on Pattern Recognition (ICPR'2010) . ... BookTitle = {Proceedings of International Conference on Pattern Recognition (ICPR'2010)}, . ... Year = {2010}, . ...

Еще в разделе: (Показать все результаты (>824) - imaging.cmc.msu.ru/ )

... Singe flower that is 2-3 inches wide and prefers humid conditions for pollination · Fruit is 1-3 inches wide and can appear dark purple to light yellow Cultivation · Prefers soil with a fairly neutral pH · Vulnerable root system that requires regular watering and excellent draining · Carpenter bees are the best for pollination · Plant should be cultivated along a fence or balcony · Begins to bear fruit after maturity, which may take 13 years ...

Еще в разделе: (Показать все результаты (>992) - herba.msu.ru/ )

• What's new?
• Insect catching and carnivorous plants
• Systema Naturae

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>92) - www.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>51) - vestnik.math.msu.su/ )

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>34) - ferro.phys.msu.ru/ )