... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>130) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>860) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>70) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

. Yu.A.Shokin . Accurate positions of variable stars in the western part of the Large Magellanic Cloud bar . (published in IBVS and SAI Proceedings ) . B.S.Vozdvijenski, N.P.Gorbatko, V.A.Yeliseev, G.V.Romanova . The results of the observations of the selected minor planets in Sternberg State Astronomical institute . (published in SAI Proceedings ) .

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

• AMT articles
• Scientific Literature

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>6) - tunka.sinp.msu.ru/ )

University Satellites and . Space Science Education . ... Aerospace and remote sensing education in the Geography schools of Moscow and Cambridge universities . ... The two well-known universities under comparison, namely the Lomonosov Moscow State University, and the University of Cambridge, UK have well established traditions of geographical remote sensing. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6703) - cosmos.msu.ru/ )

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>34) - ferro.phys.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>85) - www.msu.ru/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>130) - qi.phys.msu.ru/ )

... Rare Earth Intermetallic Compounds with a Huge Magnetostriction and Compensated Magnetic Anisotropy . ... The present work was intended to study the magnetostriction in alloys with compensated magnetic anisotropy having cubic crystal lattice of the Laves phase type with a stoichiometry R[Z]R'[1-Z]Fe[2-X]Co[X], where R and R’ are rare earth ions with single ion magnetic anisotropy constants of opposite sign and where iron was replaced by cobalt. ...

Еще в разделе: (Показать все результаты (>110) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Handling file uploads . ... The MAX_FILE_SIZE item cannot specify a file size greater than the file size that has been set in the upload_max_filesize ini-setting. ... If memory limit is enabled, larger memory_limit may be needed. Make sure to set memory_limit large enough. ... Make sure to set max_execution_time large enough. If post_max_size is set too small, large file cannot be uploaded. Make sure to set post_max_size large enough. ... Uploading multiple files ...

Еще в разделе: (Показать все результаты (>241) - oit.cmc.msu.ru/ )

• getrandmax
• mt_getrandmax
• pg_locreate

... О физическом факультете . ... Физический факультет . ... История факультета . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Серия "Выдающиеся ученые физического факультета МГУ" . ... М.: Физический факультет МГУ им. М.В.Ломоносова . ... под редакцией К.В.Показеева -- М.: Физический факультет МГУ, 2015, 376 с. Г.А.Сарданашвили . ... М.: Физический факультет МГУ . ... Константин Петрович Белов" (Серия: Выдающиеся ученые физического . ...

Еще в разделе: (Показать все результаты (>115) - phys.msu.ru/ )

• Задачи вступительных экзаменов

. General Information . Media Files . Participants . Timetable . Local Information . Photos . Back to the album list . Previous Click the image to view it in fullsize. Previous . The BTA (Bolshoi Teleskop Alt-azimutalnyi, Eng:Large Altazimuth Telescope) is a large 6 m optical telescope at the Special Astrophysical Observatory. The BTA-6 was the largest telescope in the world between its first light in 1975 and 1993.

Еще в разделе: (Показать все результаты (>22) - site2010.sai.msu.ru/ )

... This is my main interest in linguistics that I have been pursuing for a number of years. ... Spoken language . Present-day linguistics is primarily oriented towards written language. ... I am personally interested in the latter kind of research since I prefer to use first-hand knowledge rather that crucially rely on how other people interpret languages (or still other people?s writings). ... This is one of the major languages of Russia spoken by dozens of thousands of people. ...

Еще в разделе: (Показать все результаты (>278) - www.philol.msu.ru/ )

• LangueDOC :: Publications

Identifiability analysis and predictive power of the gene circuit model Ekaterina Myasnikova St.Petersburg State Polytechnical University, 29 Politekhnicheskaya, 195251, St.Petersburg, Russia, e-mail: myasnikova@spbcas.ru The correct prediction of system behavior is a necessary property of a mathematical model that is largely determined by the identifiability of model parameters. The number of parameters that are estimated by fitting to experimental data is typically large. ...

Еще в разделе: (Показать все результаты (>182) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/236.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/139.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

... This paper argues that a mixed system of private and state universities seems the best structure to secure dynamism, accessability, and efficiency of higher education insitutions in post-industrial societies. ... Whereas the university system of Germany is to a large degree state-operated, the British system combines some elements of private higher education with an also largely state-operated university system. ... The United States would seem to provide the best structure for a university system. ...

Еще в разделе: (Показать все результаты (>101) - www.prof.msu.ru/ )

• Commemoration of the centenary of Senator Fulbright's birth
• About the importance of founding teleecommunication centres in developing areas

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>45) - fgp.msu.ru/ )

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Two approaches for noise filtering in 3D medical CT-images . ... Conference paper . ... Noise in 3D computer tomography (CT) images is close to white and becomes large when patient radiation doses are reduced. We propose two methods for noise reduction in CT images: 3D extension of fast rank algorithms (Rank-2.5D) and 3D extension of a non-local means algorithm (NLM-2.5D). ...

Еще в разделе: (Показать все результаты (>819) - imaging.cmc.msu.ru/ )

• Fast rank algorithms | Laboratory of Mathematical Methods of Image Processing
• Laboratory of Mathematical Methods of Image Processing

... In the first period, the earth had two near-collisions with Venus, the first being in the time of the Hebrew exodus from Egypt and the second being on the day during Joshua's campaigns when the sun and moon stood still; see the discussion of the ?record? of the eclipse of 1130 September 30 in Section 11.2. ... During the second period, the earth had two or more near-collisions with Mars, and Velikovsky [p. 218 and p. 241] gives exact dates for the first and last of them. ...

Еще в разделе: (Показать все результаты (>120) - hbar.phys.msu.ru/ )

• Historical Eclipses
• Robert R. Newton, The Secular Acceleration of the Earth's Spin
• R.R.Newton, "Astronomical evidence..."