PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) pg_locreate -- Create a large object . int pg_locreate ( resource connection) . pg_locreate() creates an Inversion Large Object and returns the oid of the large object. connection specifies a valid database connection opened by pg_connect() or pg_pconnect() . PostgreSQL access modes INV_READ, INV_WRITE, and INV_ARCHIVE are not supported, the object is created always with both read and write access. ... It returns large object oid otherwise. ...

Еще в разделе: (Показать все результаты (>312) - oit.cmc.msu.ru/ )

• Error reporting
• Common Pitfalls
• PostgreSQL functions

Network Working Group J. Levine Internet-Draft Taughannock Networks Intended status: Standards Track February 11, 2016 Expires: August 14, 2016 Compressed Data Extension for SMTP draft-levine-smtp-compress-00 Abstract SMTP messages can be quite large. ... Levine Expires August 14, 2016 [Page 1] Internet-Draft SMTP Compression February 2016 Table of Contents 1. ... Compressed data service extension . ... Levine Expires August 14, 2016 [Page 2] Internet-Draft SMTP Compression February 2016 3. ...

Еще в разделе: (Показать все результаты (>16954) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-chroboczek-babel-applicability-01.txt
• http://mirror.msu.net/pub/rfc-editor/internet-drafts/draft-allman-tcpm-no-initwin-00.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc299.txt

... Gas bubbles in living tissues, when subjected to therapeutic ultrasound (TUS), may be found in relatively large cavities such as blood vessels, in intercellular spaces and within cells. ... For greater TUS intensity, when bubble might collapse near a surface, we study bubble behavior in confined space that simulates a tiny cavity such as intercellular space. ... In some cases, the bubble divides into two symmetrical bubbles that collapse while high velocity jets are generated, aiming at the walls. ...

Еще в разделе: (Показать все результаты (>198) - acs366.phys.msu.su/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>755) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>135) - ee-journal.spa.msu.ru/ )

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

... Moscow, Russia . ... March-October 2000 . ... Gusev A.S. Multicolor CCD Photometry of Six Lenticular and Spiral Galaxies. ... Gusev A.S., Park M.-G. Structure and stellar population of ringed barred galaxy NGC 2336 // Astronomy and Astrophysics, 2003, V.410, P.117-129. ... Gusev A.S. Photometric Properties of Bars in Galaxies // Astronomy Reports, 2000, V.44, N9, P.579-591. ... Gusev A.S. BVRI CCD Photometry of Pecular Galaxies NGC 5605 and NGC 5665 // Astronomy Reports, 2000, V.44, N9, P.569-578. ...

Еще в разделе: (Показать все результаты (>298) - lnfm1.sai.msu.ru/ )

• Maidanak Lab page
• List of publications
• Works and publications by Leonid Zotov Works and publications by Leonid Zotov

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>87) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

... Optical tweezers and photonic force microscopy . ... Student (till February 2015) . ... Danil A. Shilkin, Evgeny V. Lyubin, Irina V. Soboleva, and Andrey A. Fedyanin . ... 2015 . ... Photonic force microscopy of surface electromagnetic waves in a one-dimensional photonic crystal" . ... D. A. Shilkin, E. V. Lyubin, I. V. Soboleva, and A. A. Fedyanin . ... D.A. Shilkin, E.V. Lyubin, I.V. Soboleva, A.A. Fedyanin . ... Irina V. Soboleva, Daniil A. Shilkin, Evgeny V. Lyubin, Andrey A. Fedyanin . ...

Еще в разделе: (Показать все результаты (>164) - nanolab.phys.msu.ru/ )

• Gulkin Dmitriy N. | Laboratory of Nanophotonics & Metamaterials
• Nanophotonics of surface states in photonic crystals | Laboratory of
• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>35) - ferro.phys.msu.ru/ )

Laboratory of Microfluidics and Nanofluidics . Laboratory of Physical Chemistry of Modified Surfaces . ... Research . ... Laboratory of Micro- and Nanofluidics . ... Professor B.V.Derjaguin moved to the Laboratory with his research group as an Emeritus Professor. ... In 1993 Professor Olga I. Vinogradova took over the leadership of the Laboratory. In 2009 the Laboratory of Micro- and Nanofluidics was organized by Professor Olga I. Vinogradova at the Physics Department of the M.V.Lomonosov MSU. ...

Еще в разделе: (Показать все результаты (>61) - nanofluidics.phys.msu.ru/ )

• Publications
• Taras Y. Molotilin
• Olga I. Vinogradova

... Our understanding of quantum gravity suggests that at the Planck scale the usual geometry loses its meaning. ... Singular unification: an unification of all fundamental interactions at the Planck scale in the form of a Universal Landau Pole (ULP), at which all gauge couplings diverge. ... The unification is achieved with the addition of fermions with vector gauge couplings coming in multiplets and with hyp ercharges identical to those of the Standard Mo del. Stability of the Higgs Potential. ...

Еще в разделе: (Показать все результаты (>150) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/ginzbbdark100912.pdf
• http://qfthep.sinp.msu.ru/talks/pr_Gamzova.pdf
• http://qfthep.sinp.msu.ru/talks2013/StPetersburg_SM08f.pdf

Contemplating the evolution of Surface Nonlinear Optics seems to be highly instructive, able to stimulate one's own creativity and deeper understanding of current trends in this field. ... Hence, the Surface Nonlinear Optics Map, in its starting version, presents the names of researchers having made prominent scientific contributions to this branch of Optics. Related websites are accessible by clicking the corresponding names. ...

Еще в разделе: (Показать все результаты (>52) - shg.phys.msu.ru/ )

• List of selected publications

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>129) - qi.phys.msu.ru/ )

... B. A. Grishanin, Quantum Electrodynamics for Physicists, 1983 (Moscow State Univ: Moscow), in Russian. B. A.Grishanin, V. M.Petnikova, and V. V. Shuvalov, Non-stationary Four-Photon Spectroscopy of Semiconductors, In: Modern Problems in Laser Physics, vol. 2, 1990 (VINITI: Moscow), in Russian. ... Laser Physics, 3, pp. ... B. A. Grishanin and V. N. Zadkov, ?Natural capacity of a system of two two-level atoms as a quantum information channel,? ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>93) - qilab.phys.msu.ru/ )

. Any UNIX system can have many users on it at any one time. As a user you are given a home directory in which you are placed whenever you log on to the system. User's home directories are usually grouped together under a system directory such as /home . A large UNIX system may have several hundred users, with their home directories grouped in subdirectories according to some schema such as their organisational department. Example . Did You Know? .

Еще в разделе: (Показать все результаты (>123) - comet.sai.msu.ru/ )

• Previous and Proposed
• Network domains and mail addresses
• Digitized Sky Engines

... Institutes of Chernogolovka . The largest of all the scientific institutions of the center is the Institute of Chemical Physics in Chernogolovka , where fundamental problems of chemical physics are studied: kinetics and mechanisms of chemical and biological processes; processes of combustion, explosion, and polymerization; and mechanisms of elementary reactions involving high energy particles. ... Developments and Technologies . ...

Еще в разделе: (Показать все результаты (>12) - www.issp.ac.ru/ )

• Problems of the 1-st International Astronomy Olympiad
• II International Astronomy Olympiad, Problems to solve

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>44) - cdfe.sinp.msu.ru/ )

• CDFE => Online services => Chart of Nuclear Quadrupole Deformations

... Yu.A.Shokin Accurate positions of variable stars in the western part of the Large Magellanic Cloud bar (published in IBVS (No.5047, 14 March 2001) and SAI Proceedings) . B.S. Vozdvizhenskij The list of 2821 Venus positions (VINITI depository Oct 08 2007, N 956 B2007) . B.S. Vozdvizhenskij, E.N. Fedosseev The experience in processing long series of photographic observations of planetary positions (VINITI depository Apr 01 2008, N 274 B2007) . ...

Еще в разделе: (Показать все результаты (>7) - astrometric.sai.msu.ru/ )

• AMT catalogs

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>21) - observ.pereplet.ru/ )