... Gas bubbles in living tissues, when subjected to therapeutic ultrasound (TUS), may be found in relatively large cavities such as blood vessels, in intercellular spaces and within cells. ... For greater TUS intensity, when bubble might collapse near a surface, we study bubble behavior in confined space that simulates a tiny cavity such as intercellular space. ... In some cases, the bubble divides into two symmetrical bubbles that collapse while high velocity jets are generated, aiming at the walls. ...

Еще в разделе: (Показать все результаты (>213) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
• ISNA-16
• Schedule : Nonlinear Acoustics of the Atmosphere, the Ocean, and the Earth

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>13) - www.ecocoop.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>671) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/nazmutdinov.pdf

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>87) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

... List of Publications . ... L.N. Rashkovich, A.S. Filonov, and I.V. Yaminsky, Shape of Steps on the (010) Face of Orthorhombic Lysozyme Crystals - Crystallography Reports, 2008, 53(2), 320-325. ... I.V. Yaminsky, A.S. Filonov, A.V. Bolshakova, N.I. Nikonorova, Local Properties Study of Nanostructured Materials via Internet Probe Microscopy // Lomonosov Conference 2007, Moscow, April, 2007, Conference Proceedings . ... E.V. Dubrovin, A.S. Filonov, G.B. Meshkov, O.V. Sinitsyna, I.V. Yaminsky. ...

Еще в разделе: (Показать все результаты (>157) - www.spm.genebee.msu.ru/ )

• List of my publications issued in 1996-2002
• List of my publications issued in 2003-
• Anastasia's Main Page

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>29) - site2010.sai.msu.ru/ )

• Observatories

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>35) - ferro.phys.msu.ru/ )

... MPI_Offset Type . ... Physical File Layout Previous: Miscellaneous Clarifications . MPI_Offset is an integer type of size sufficient to represent the size (in bytes) of the largest file supported by MPI. Displacements and offsets are always specified as values of type MPI_Offset. ... In Fortran 77 environments that do not support KIND parameters, MPI_Offset arguments should be declared as an INTEGER of suitable size. ... Центры . ...

Еще в разделе: (Показать все результаты (>503) - www.parallel.ru/ )

• File Offsets | PARALLEL.RU - Информационно-аналитический центр по параллельным
• FFTW - Footnotes | PARALLEL.RU - Информационно-аналитический центр по
• Decoding a Datatype | PARALLEL.RU - Информационно-аналитический центр по

Contemplating the evolution of Surface Nonlinear Optics seems to be highly instructive, able to stimulate one's own creativity and deeper understanding of current trends in this field. ... Hence, the Surface Nonlinear Optics Map, in its starting version, presents the names of researchers having made prominent scientific contributions to this branch of Optics. Related websites are accessible by clicking the corresponding names. ...

Еще в разделе: (Показать все результаты (>51) - shg.phys.msu.ru/ )

• List of selected publications

... 11- 0++ 0 KK BR = 83% (1020) a0(980) f0(980) BR ~ O(10 ' s BR = 6.210 BR = 15% BR = 1.3% BR = 1.310 T (1GeV) 80 nb scan MeV pb KLOE 2001-2005 data ISR s W s s ger Tag KLOE : Fv(W) in e+e-+-() sity o min Lu BR(KS 3 0): UL KS 3 0 CP violating not yet observed -9 SM (ChPT): BR(KS 3 0) = 1.9·10 data 2 ev/bkg New KLOE2013: PLB723( 2013 ) 54 L=1.7 fb-1 indepen improved selection signal eff. ( ... A(X,Y)|2=N(1+aY+bY2+dX2+fY3+gX2Y) New analysis PRELIMINARY (no syst. ): f0 confirmed fits with g......

Еще в разделе: (Показать все результаты (>181) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Teryaev_lom09.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Weiser.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/250809/Polikarpov/polikarp.pdf

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>128) - qi.phys.msu.ru/ )

05 Nov 2003 The Sun has continued its recent high levels of activity. At 1950 UT, 4 November 2003, a class X28 solar flare was released by the Sun. ... LASCO C2 Images of X28 Flare at 1950UT 04/11/2003 . ... SOHO (Solar and Heliospheric Observatory) is located between the Sun and the Earth and will, therefore, detect activity before it reaches the Earth. ... All this ongoing solar activity means that the Earth is destined to be bathed in more radiation - generating further auroral displays. ...

Еще в разделе: (Показать все результаты (>205) - www.kosmofizika.ru/ )

• July 15, 2000 North American view Animation
• Top Story - X 17.1 Flare Observed - October 28, 2003
• L.Lazutin, List of publications

Igor P. Lokhtin . Participation in Conferences, Workshops and Schools in High Energy Physics . ... 18th Annual RDMS CMS Collaboration Conference . ... The 15th International Conference on Strangeness in Quark Matter . ... XXII International Workshop on High Energy Physics and Quantum Field Theory . ... International Conference-Session of the Section of Nuclear Physics of the Physical Sciences Division of Russian Academy of Sciences "Physics of Fundamental Interactions" . ... 4 March, 2011 (CERN) . ...

Еще в разделе: (Показать все результаты (>60) - lav01.sinp.msu.ru/ )

• Etapi- Comments 3/1/97

... Phys. Lett., ... Phys. Rev. E, 2015, V.91, 033020 ( PDF ) . ... E.S.Asmolov, A.V.Belyaev and O.I.Vinogradova, Drag force on a sphere moving towards an anisotropic super-hydrophobic plane, Phys. Rev. E, 2011, V.84, 026330 ( PDF ) . ... F.Feuillebois, M.Z.Bazant and O.I.Vinogradova, Effective Slip over Superhydrophobic Surfaces in Thin Channels, Phys. Rev. Lett., ... O.I.Vinogradova and G.E.Yakubov, Surface Roughness and Hydrodynamic Boundary Conditions , Phys. Rev. E, 2006, V.73, 045302(R) ( PDF ) . ...

Еще в разделе: (Показать все результаты (>61) - nanofluidics.phys.msu.ru/ )

• Laboratory of Micro- and Nanofluidics
• Theses
• Olga I. Vinogradova

University Satellites and . Space Science Education . ... Aerospace and remote sensing education in the Geography schools of Moscow and Cambridge universities . ... The two well-known universities under comparison, namely the Lomonosov Moscow State University, and the University of Cambridge, UK have well established traditions of geographical remote sensing. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6704) - cosmos.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>91) - www.msu.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... The laboratory of chemistry and physics of sensor and semiconductor materials is the largest laboratory of Inorganic chemistry department , Lomonosov Moscow State University. The laboratory staff include 21 members and there are 25 students and postgraduate students of Chemistry Faculty , Physics Faculty and Faculty of Materials Science . ... semiconductor materials for sensors . ... Phone: +7(495) 939 54 71 . ...

Еще в разделе: (Показать все результаты (>73) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials |

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>108) - ee-journal.spa.msu.ru/ )