sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>481) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

... Moscow, Russia . ... March-October 2000 . ... Gusev A.S. Multicolor CCD Photometry of Six Lenticular and Spiral Galaxies. ... Gusev A.S., Park M.-G. Structure and stellar population of ringed barred galaxy NGC 2336 // Astronomy and Astrophysics, 2003, V.410, P.117-129. ... Gusev A.S. Photometric Properties of Bars in Galaxies // Astronomy Reports, 2000, V.44, N9, P.579-591. ... Gusev A.S. BVRI CCD Photometry of Pecular Galaxies NGC 5605 and NGC 5665 // Astronomy Reports, 2000, V.44, N9, P.569-578. ...

Еще в разделе: (Показать все результаты (>488) - lnfm1.sai.msu.ru/ )

• Maidanak Lab page
• List of publications
• Works and publications by Leonid Zotov Works and publications by Leonid Zotov

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>20) - www.elch.chem.msu.ru/ )

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>103) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

... Moscow State University . Russian Academy of Sciences . ... December, 2015 (Moscow State University, Department of Physics) . ... June, 2013 (Moscow State University, Department of Chemistry) . ... August, 2012 (Moscow State University, Department of Physics) . ... June, 2012 (Moscow State University, Department of Chemistry) . ... June, 201 1 (Moscow State University, Department of Materials Science) . ... 2015 (Moscow State University) . ... 2012 (Moscow State University) . ...

Еще в разделе: (Показать все результаты (>61) - nanofluidics.phys.msu.ru/ )

• Laboratory of Micro- and Nanofluidics
• Publications
• Belyaev

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... 11 , 065203 (2014). ... Quantum key distribution (QKD) is a concept of secret key exchange supported by fundamentals of quantum physics. ... Download [ help ]: . Download paper: doi page . Download paper: link to publisher . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>123) - qi.phys.msu.ru/ )

... October, 2005 . ... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! ... You will not only learn Russian for your professional career, but also learn a lot about Russia and its people that will allow you to communicate with your Russian clients more efficiently. www.rlcentre.com . ... Europalia International welcomes the biggest country in the world to a new edition of its multidisciplinary and edifying festival. ...

Еще в разделе: (Показать все результаты (>14) - www.rlcentre.com/ )

OLEA EUROPAEA (OLIVE) OLIVE TAXONOMY Kingdom: plantae Order: lamiales Family: Oleaceae Genus: Olea Species: O. Europaea MORPHOLOGY Root System: great root system allows tree to grow in dry climates could grow from 15cm to 6 meters depending on the climate and type of soil Trunk: younger trees have smooth gray/green bark. ... HARVESTING Harvesting for Oil Step 1 Harvest as soon as the fruit reaches maximum size. ... Tree shakers and mechanical rakes can also be used when harvesting olives for oil. ...

Еще в разделе: (Показать все результаты (>295) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_240/en/open/cochlearia_c.txt
• Systema Naturae

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>133) - ee-journal.spa.msu.ru/ )

Supernova 1987A in LMC . One day in 1987, an astronomer by the name of Ian Shelton was making observations of the Tarantula Nebula in Large Magellanic cloud at Las Campanas Observatory, and he noticed something strange on his image. ... SN 1987A got as bright as 2.7, the only other recent SN even to come close was 1885A in M31 which got up to mag 6. ... Mag 4.5 . ... IAUC 4318 2/25/87 Type II? ... IAUC 7354 2/1/00 New structure in the inner ring . ... IAUC 7360 2/7/00 HST observation of new spot . ...

Еще в разделе: (Показать все результаты (>55) - www.rochesterastronomy.org/ )

... Handling file uploads . ... The MAX_FILE_SIZE item cannot specify a file size greater than the file size that has been set in the upload_max_filesize ini-setting. ... If memory limit is enabled, larger memory_limit may be needed. Make sure to set memory_limit large enough. ... Make sure to set max_execution_time large enough. If post_max_size is set too small, large file cannot be uploaded. Make sure to set post_max_size large enough. ... Uploading multiple files ...

Еще в разделе: (Показать все результаты (>143) - oit.cmc.msu.ru/ )

• pg_locreate
• PostgreSQL functions
• pg_loopen

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... Yu.A.Shokin Accurate positions of variable stars in the western part of the Large Magellanic Cloud bar (published in IBVS (No.5047, 14 March 2001) and SAI Proceedings) . B.S. Vozdvizhenskij The list of 2821 Venus positions (VINITI depository Oct 08 2007, N 956 B2007) . B.S. Vozdvizhenskij, E.N. Fedosseev The experience in processing long series of photographic observations of planetary positions (VINITI depository Apr 01 2008, N 274 B2007) . ...

Еще в разделе: (Показать все результаты (>11) - astrometric.sai.msu.ru/ )

• AMT catalogs

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... The laboratory of chemistry and physics of sensor and semiconductor materials is the largest laboratory of Inorganic chemistry department , Lomonosov Moscow State University. The laboratory staff include 21 members and there are 25 students and postgraduate students of Chemistry Faculty , Physics Faculty and Faculty of Materials Science . ... semiconductor materials for sensors . ... Phone: +7(495) 939 54 71 . ...

Еще в разделе: (Показать все результаты (>72) - www.lssm.inorg.chem.msu.ru/ )

... Optical forces induced by Blo ch surface waves on a one-dimensional photonic crystal Shilkin D.A.1, Lyubin E.V.1 , Sob oleva I.V.1,2, Fedyanin A.A.1 1 Faculty of Physics , Lomonosov Moscow State University, 119991 Moscow , Russia 2 A.N. Frumkin Institute of Physical Chemistry and Electro chemistry, Russian Academy of Science, Moscow 119991, Russia e-mail: fedyanin@nanolab.phys.msu.ru Blo ch surface waves ( BSW ) are ...

Еще в разделе: (Показать все результаты (>166) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/gulkin_dd15.pdf
• Nanophotonics of surface states in photonic crystals | Laboratory of
• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Surface tension and dynamic contact angle analysis for liquid droplets . ... The method procedures are well established but still require high quality drop images to measure the surface tension automatically, what may be the problem in difficult experimental conditions. In this paper, the highly automated methods of surface tension and dynamic contact angle measurement are presented. ...

Еще в разделе: (Показать все результаты (>810) - imaging.cmc.msu.ru/ )

• Publications | Laboratory of Mathematical Methods of Image Processing

You may see figures of this paper below... or download the whole paper in PostScript or LaTeX source , everything compressed by ZIP. LaTeX notes: you would need some specific LaTeX styles . See CS-11 HomePage for more. Figures are in EPS (Encapsulated PostScript) format to be inserted using software like dvips . You can download these files via ftp. If you use GIF format, choose "Save Image As..." on the images below, or click here: first and second . Figure 1. ...

Еще в разделе: (Показать все результаты (>20) - uranus.sai.msu.ru/ )

• Igor Antokhin

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>229) - observ.pereplet.ru/ )

• Images

... ACAT'2003 : IX INTERNATIONAL WORKSHOP ON ADVANCED COMPUTING AND ANALYSIS TECHNIQUES IN PHYSICS RESEARCH (ACAT03), 1-5 December, 2003, Tsukuba, Japan. ... Advanced Statistical Methods for Data Analysis Traditionally, researchers from high energy and nuclear physics together with experts in computer science take part in the ACAT series of workshops. ... Thus, researchers from these and other fields are welcome to join us in discussions on modern computing techniques and ways for new developments. ...

Еще в разделе: (Показать все результаты (>48) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/24june.html
• http://acat02.sinp.msu.ru/26june.html
• http://acat02.sinp.msu.ru/25june.html

... Using Disks and Other Storage Media . ... The terminology is a bit confusing here: in MS-DOS, the word formatting is used to cover also the process of creating a filesystem (which will be discussed below). ... During formatting one might encounter bad spots on the disk, called bad blocks or bad sectors . ... Total capacity 1440 kB. ... Formatting ... done Verifying ... read: Unknown error $ The badblocks command can be used to search any disk or partition for bad blocks (including a floppy). ...

Еще в разделе: (Показать все результаты (>160) - itpm.msu.su/ )

• UUCP Over TCP
• Hard disks
• Allocating swap space