Invisible Higgs in weak bosons associative production with heavy quarks at LHC Sergei Demidov Institute for Nuclear Research RAS in collaboration with E. Boos (SINP MSU) and D. Gorbunov (INR RAS) 9 September, 2010 E. Boos, D. Gorbunov, S. Demidov (INR RAS) Invisible Higgs 9 September, 2010 1 / 15 Introduction Standard Model. ... 2003) Why does missing pT come from Higgs boson? ... V via q q VV scattering where q is Higgs mass range mH < 2MV , vir tual Higgs, probing the Higgs width H . ...

Еще в разделе: (Показать все результаты (>179) - qfthep.sinp.msu.ru/ )

• Travel Information
• September 14, 2010
• September 13, 2010

... Proceedings 2009 . ... It is discussed the active centre model of the polynucleus enzyme-ferredoxin, containing four iron ions (Fe (II)), surrounded with sulfur ions. ... According to this model the iron ion Fe (II) is in tetrahedral complex of weak ligand field. Iron ion gives vacant orbits for unshared electron pairs of the ligand sulfur ions. The ferredoxin functional mechanism may be explained with unpaired electron leaving of the cluster molecular orbit e* (transition Fe (II) - Fe (III)). ...

Еще в разделе: (Показать все результаты (>13784) - www.mce.biophys.msu.ru/ )

• Modeling of the processes connected to nucleon cluster effects

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>2675) - www.snto-msu.net/ )

• музыкальные фесты и тусовки - Public forum of MSU united student networks

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>4385) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• музыкальные фесты и тусовки - Public forum of MSU united student networks
• Серьезные картинки - Public forum of MSU united student networks

Nuclear Instruments and Methods in Physics Research B 206 (2003) 902­906 www.elsevier.com/locate/nimb Generation of the large current cluster ion beam T. Seki a c a,b,* , J. Matsuo a, G.H. Takaoka a, I. Yamada b,c Ion Beam Engineering Experimental Laboratory, Kyoto University, Sakyo, Kyoto 606-8501, Japan b Collaborative Research Center for Cluster Ion ... The intensity of neutral cluster beam increased with source gas pressure. ... The beam current increased with source gas pressure. ...

Еще в разделе: (Показать все результаты (>112) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb237_455_1maclasterionSource.pdf
• Статьи, подготовленные для публикации в журнале Nuclear Instruments and Methods

... We have explained extra solvent power of some of the ILs in comparison with nonionic liquids [1]. ... 1] A.A. Aerov, A.R. Khokhlov, I.I. Potemkin, " Why ionic liquids can possess extra solvent power ", Journal of Physical Chemistry B , 2006 , 110 , 16205-16207 . 2] A.A. Aerov, A.R. Khokhlov, I.I. Potemkin, " Interface between ionic and nonionic liquids. ... 4] A.A. Aerov, A.R. Khokhlov, I.I. Potemkin, " Amphiphilic Ionic Liquid in a Mixture of Nonionic Liquids: Theoretical Study ", J. Phys. Chem. ...

Еще в разделе: (Показать все результаты (>337) - polly.phys.msu.ru/ )

• Selected publications of Timofeeva, Galina Ivanovna
• SfP 974173 - Publications
• Selected publications of Ivanov, Viktor Alexandrovich

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>10) - www.dubinushka.ru/ )

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>25) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>10) - lab106.imec.msu.ru/ )

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>249) - www.geogr.msu.ru/ )

... The First (Experimental) International Astronomy Olympiad . The following olympic problems were proposed for the participants on the theoretical part: Grades 8-10 . ... Why is it sometimes better to use a small telescope in orbit around the Earth than it is to use a large telescope on a mountain top? ... What will an observer looking to the Moon through the telescope see? ... Paper with a drown circle and table of maximal elongations of Mercury and Venus had been done for participants. ...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• II International Astronomy Olympiad, Problems to solve
• Institutes of Chernogolovka
• Comet Ephemerides

D.Moss, D.Sokoloff, R.Beck, Ram pressure effects in the galactic plane and galactic dynamos in the no-z approximation, Astron. Astrophys., 544, A5, 4 pages, 2012 . ... To isolate the leading physical effects, we exploit a simple dynamo model that can describe relevant effects. ... Any determination of galactic motion through the cluster medium from observational data needs to take the effects of dynamo action into account. ...

Еще в разделе: (Показать все результаты (>85) - srcc.msu.ru/ )

• Beck R., Frick P., Stepanov, R., Sokoloff D. Recognizing magnetic structures by
• Laboratory of Informatics
• Moss D., Sokoloff D., Beck R., Ram pressure effects in the galactic plane and

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3321) - hist.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>1414) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>9) - www.ecocoop.ru/ )

Microsymposium 34, MS015, 2001 TO THE DISCOVERY OF THE "SOUTH POLE - AITKEN " BASIN. ... Head [2] and Spudis [1] suggested in their reviews that the existense of the structure identified later as the South Pole - Aitken baasin was first predicted on the basis of a relief analysis of the mountain ridges observed in the libration zone be Hartman and Kuiper [7], i.e. after the first images of the lunar far-side had been obtained. ... SOUTH POLE-AIKEN BASIN: V.I.Chikmachev et al. ...

Еще в разделе: (Показать все результаты (>123) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.doc
• http://selena.sai.msu.ru/Symposium/lipskiy.pdf
• http://selena.sai.msu.ru/Greg/Publications/ms38/ms090.pdf