... Topology, Geometry, and Dynamics: Rokhlin Memorial . ... 11-16 January 2010 . ... Group Actions in Topology and Geometric Group Theory . 3rd GAF Conference . ... 14-18 June 2010 . ... International Conference on Topology and its Applications . ... 27 June-3 July 2010 . ... International Conference . ... 4th GAF Conference . ... Topology ATLAS: Conferences and Seminars . British Topology conference list (maintained by Sarah Whitehouse) . ... Group Action Forum (GAF) conference page . ...

Еще в разделе: (Показать все результаты (>231) - higeom.math.msu.su/ )

• Publications (English)
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1969
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1970

. Update is coming soon.

Еще в разделе: (Показать все результаты (>126) - comet.sai.msu.ru/ )

• Dm. Bizyaev's Publications
• The IMG (Image) Element
• Who the permissions apply to

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>2532) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/deltaaligned.fasta

... International Conference Advanced Carbon Nanostructures (ACNS'2015), June 29 - July 3, 2015, St. Petersburg, Russia. ... March 20, 2012, Moscow, Russia. ... IX International Conference Atomic and Molecular Pulsed Lasers, September 14th-18th, 2009, Tomsk, Russia. 21st Colloquium on High Resolution Molecular Spectroscopy, August 31st-September 4th 2009, Castellammare di Stabia, Italy. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>45) - rswater.phys.msu.ru/ )

• Sergey Burikov
• Tatiana Dolenko
• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

... Collaborative Research Center for Cluster Ion Beam Process Technology . ...

Еще в разделе: (Показать все результаты (>119) - danp.sinp.msu.ru/ )

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>168) - ee-journal.spa.msu.ru/ )

... Furman and A.V.Tikhonravov, "Basics of optics of multilayer systems" , Editions Frontiers, Gif-sur Yvette, 1992, 242 p. A.V. Tikhonravov, M.K. Trubetskov, I.V. Zuev and P.G. Verly, "Efficient Refinement of Inhomogeneous Optical Coatings", in "Optical Interference Coatings", OSA Technical Digest Series, vol. ... A.V. Tikhonravov, M.V. Klibanov, I.V. Zuev, "Numerical study of the phaseless inverse scattering problem in thin film optics", Inverse problems, 1995, Vol. 11, pp. ... Основные публикации . ...

Еще в разделе: (Показать все результаты (>29) - www.srcc.msu.ru/ )

... My research topic is application of the theory of dynamical systems to models of excitable media. ... One of the remarkable examples of an excitable medium is heart tissue. ... We have observed dynamics of phase singularities using some of the techniques for PS detection on the base of just one framework three-variable Fenton-Karma model with different parameters sets to reproduce various mechanisms of spiral wave breakup which in principle can occur in cardiac tissue. ...

Еще в разделе: (Показать все результаты (>428) - polly.phys.msu.ru/ )

• Publications
• NATO Scientific & Environmental Affairs
• Seminar in Polymer Physics - 1999

... CC Large Hall, Chair G. Passarino . ... P. Shawhan, LIGO Data Analysis (ID=522) 30 min . D. Buskulic, Data Analysis Software Tools used during VIRGO Engineering Runs, review and future needs (ID=504) 30 min Plenary Session, 11:30 - 13:30 . ... J. Moscicki, A Component Framework for Distributed Parallel Data Analysis in HEP (ID=306) 25 min Parallel Session, 15:00 - 16:50 . ... A. Soloviev, Application of Wavelet Analysis for Data Treatment of Small-Angle Neutron Scattering. ID=269) 20 min . ...

Еще в разделе: (Показать все результаты (>73) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/topics.html
• http://acat02.sinp.msu.ru/deadlines.html
• http://acat02.sinp.msu.ru/24june.html

... of the group collaborators laboratory for several last years. ... 1997 . ... Dedushenko S.K., Kholodkovskaya L.N., Perfiliev Yu.D., Kiselev Yu.M., Saprykin A.A. The new phases of iron in higher oxidation states? ... Dedushenko S.K., Kulikov L.A., Perfiliev Yu.D., Saprykin A.A., Lemesheva D.G. Moessbauer spectroscopy of iron and cobalt in higher oxidation states. ... Dedushenko S.K., Perfiliev Yu.D., Kiselev Yu.M., Andrianov V.A., Kozin M.G. Moessbauer study of sodium ferrate: quadrupole interaction....

Еще в разделе: (Показать все результаты (>865) - chem.msu.ru/ )

• Molecular mechanics force field based on Gillespie-Kepert model: application to
• Science Department
• Colossal Magnetoresistive thin films of (La1-xPrx)0.7Ca0.3MnO3 prepared by

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

PHP Manual . ... History of PHP . History of PHP related projects . Books about PHP . ... One of the biggest strengths of PHP 3.0 was its strong extensibility features. ... The whole new language was released under a new name, that removed the implication of limited personal use that the PHP/FI 2.0 name held. ... PHP 4.0, based on this engine, and coupled with a wide range of additional new features, was officially released in May 2000, almost two years after its predecessor, PHP 3.0. ...

Еще в разделе: (Показать все результаты (>349) - oit.cmc.msu.ru/ )

• Common Pitfalls
• Publications about PHP
• create_function

... Department of Mathematics, . Faculty of Physics, MSU . ... Differential equations . ... Mathematical analysis 2 . Numerical Methods (A.N. Bogolyubov) . Numerical methods in physics . ... Abstract differential equations with applications in mathematical physics . ... Asymptotic methods in nonlinear problems of mathematical physics . ... Methods of finite differences in mathematical physics . ... April 13, 2016. ... Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016 ...

Еще в разделе: (Показать все результаты (>10) - math.phys.msu.ru/ )

... Полная версия этой страницы: PhD in Astrophysical Sciences, Princeton, USA . Студенческий форум Физфака МГУ > Физфак и учеба > Аспирантура . ... The Department of Astrophysical Sciences, Princeton University (USA), . ... and related sciences and carry out original research in observational . ... of Astrophysical Sciences at Princeton include the Apache Point . ... Members of the department have access to state-of-the-art . ... life in the Department see http://www.princeton.edu/astro/graduate/ . ...

Еще в разделе: (Показать все результаты (>611) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Barclays Capital 2009
• Студенческий форум Физфака МГУ > A large IT company is looking for J2EE
• Студенческий форум Физфака МГУ > A large company is looking for Senior J2EE

... Что такое ОТиПЛ? ... XLV Традиционная олимпиада по лингвистике . В отборочном туре приняло участие 3235 человек. Переведено на I тур 930 человек. I тур: 8 февраля, МГУ . II тур: 1 марта, РГГУ . ... Теоретическая и прикладная лингвистика: пути развития (к юбилею В. А. Звегинцева и ОСиПЛ / ОТиПЛ) (2010) . Образовательный стандарт МГУ по фундаментальной и прикладной лингвистике (ФиПЛ) . ... В отборочном туре XLV Традиционной олимпиады по лингвистике приняло участие 3235 человек. ...

Еще в разделе: (Показать все результаты (>360) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/cv.html
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/teaching.html
• MSCL-3 | Home

Software on Data Processing . We Offer Statistical Software And . Software On Data Analysis And Processing. ... The package is intended for those, who doesn't have large experience in statistical analysis, but needs a quick and convenient data processing tool. ... Package provides full complex of registration and analysis methods, individual EKG monitor-analyzer, special tools for complete polygraph analysis. price: 700$ - 2200$. phone number (095) 437-3695, 155-1365 . ... InCo . ...

Еще в разделе: (Показать все результаты (>5) - statsoft.msu.ru/ )

• InCo literature in English

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Type of field courses . ... How to apply . ... The Faculty of Geography has a rich experience in studying of international students. ... If an applicant doesn t know Russian properly, he may address to the Centre of International Education (CIE) . ... For further information you may contact the department of International Education of the Faculty of Geography: . ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Application
• Department of Land Hydrology
• Publications

... A This result can be applied to a wide variety of data sets, including electricity bills1, street addresses, lengths of rivers, physical and mathematical constants, and processes described by power laws. ... Based on the plausible4 assumption that people who make up figures tend to distribute5 their digits fairly uniformly, a simple comparison of first-digit frequency distribution from the data with the expected distribution according to Benford's law had to show up any anomalous results. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/dictionary.pdf

. This page uses frames, but your browser doesn't support them.

Еще в разделе: (Показать все результаты (>122) - num-anal.srcc.msu.ru/ )