... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>8355) - www.fds-net.ru/ )

• У кого есть Sims hot date или Livin'large или еще что-нибудь?? - Public forum
• Серьезные картинки - Public forum of MSU united student networks

... Hobby >> Media >> Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: darktemplar ] . ... 30.09.2006 . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Angren ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Troop ] . ... Re: Tumour - Too Large For Digestive Capacity - 2006, MP3, VBR [ re: Anonymous ] . ...

Еще в разделе: (Показать все результаты (>6031) - www.snto-msu.net/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>5451) - monkey.belozersky.msu.ru/ )

• SCOP classification

День Физика . ... Новости . ... Абитуриентам . ... Главная Новости Наука . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>4) - www.dubinushka.ru/ )

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>3514) - istina.msu.ru/ )

• M?gi M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kr?l M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Ekaterinburg department of the Association " Professionals for Cooperation" is announcing the conference of USIS Educational Programs Alumni which will be held in Ekaterinburg on October 19-21, 2000 in the House of Actor. At the end of the XX century and on the eve of the III millennium Russia found itself at the crossroads: good intentions of building a democratic state with civic liberties and market economy turned out to be largely unsuccessful and unrealistic. ... Conference Board: . ...

Еще в разделе: (Показать все результаты (>110) - www.prof.msu.ru/ )

• Commemoration of the centenary of Senator Fulbright's birth
• WHICH UNIVERSITY SYSTEM IS BEST?
• Conferences & Publications

... The Second International Astronomy Olympiad . ... Problems to solve, 8-10 Form Text of these problems is available in Russian too. ... Two stars have the same absolute magnitude. ... The orbital period of Mars is 687 days. ... See problem 2. for 8-10 Form. ... Problem to solve, 9-12 Form Text of the problem is available in Russian too. ... Problem is about Doppler-effect, to find velosities of two stars using their spectra and spectrum of our Sun, to estimate speed of the Earth moving around the Sun...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• Institutes of Chernogolovka

... Nonlinear fiber optics . ... member of the Editorial Board for the Laser Physics journal . ... Member of the steering committee of the international conference on Raman spectroscopy (ICORS): Budapest, 2002; Brisbane, 2004; Yokohama, 2006; London, 2008 . Member of the steering committee of the International Laser Physics workshop: Bratislava, 2002; Hamburg, 2003; Trieste, 2004; Kyoto, 2005; Lausanne, 2006; Leon, 2007; Trondheim, 2008; Barcelona, 2009 . ... International conference ?Laser Optics? ...

Еще в разделе: (Показать все результаты (>48) - photonicslab.phys.msu.ru/ )

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) pg_locreate -- Create a large object . int pg_locreate ( resource connection) . pg_locreate() creates an Inversion Large Object and returns the oid of the large object. connection specifies a valid database connection opened by pg_connect() or pg_pconnect() . PostgreSQL access modes INV_READ, INV_WRITE, and INV_ARCHIVE are not supported, the object is created always with both read and write access. ... It returns large object oid otherwise. ...

Еще в разделе: (Показать все результаты (>243) - oit.cmc.msu.ru/ )

• Common Pitfalls
• PostgreSQL functions
• pg_loopen

The Chair of Mathematical Theory of Intelligent Systems and . ... Staff . ... Gasanov Elyar Eldarovich was born on November 14, 1959, in Moscow. ... In Moscow State University, E.E. Gasanov lectures the special courses "Theory of intelligent systems", "Theory of databases and information retrieval", "Additional chapters of discrete mathematics and mathematical cybernetics" and holds a special seminar in problems of complexity of search algorithms. ... Gasanov E.E. Instantly solvable search problems. ...

Еще в разделе: (Показать все результаты (>89) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Zhuk Dmitriy
• Intelligent Systems :: Science :: Conference :: 9th International Conference
• Intelligent Systems :: Staff :: Pankratiev Anton Evgenyevich

... J. 15(1): 33-34 ї RUSSIAN ENTOMOLOGICAL JOURNAL, 2006 A new Aphodius species of the subgenus Sinodiapterna from Far East Russia (Coleoptera: Scarabaeidae) Новый вид Aphodius подрода Sinodiapterna с Дальнего Востока России (Coleoptera: Scarabaeidae) A.A. Gusakov А.А. Гусаков Zoological Museum of the Moscow Lomonosov State University, Bolshaya Nikitskaya 6, Moscow 125009, Russia. ... KEY WORDS: Coleoptera, Scarabaeidae, Aphodius, new species, Far East of Russia. ...

Еще в разделе: (Показать все результаты (>1330) - zmmu.msu.ru/ )

• Hemprich's bat
• Tropical centre
• Mammalian humerus from the Early Cretaceous of West Siberia.

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>6445) - hist.msu.ru/ )

OLEA EUROPAEA (OLIVE) OLIVE TAXONOMY Kingdom: plantae Order: lamiales Family: Oleaceae Genus: Olea Species: O. Europaea MORPHOLOGY Root System: great root system allows tree to grow in dry climates could grow from 15cm to 6 meters depending on the climate and type of soil Trunk: younger trees have smooth gray/green bark. ... HARVESTING Harvesting for Oil Step 1 Harvest as soon as the fruit reaches maximum size. ... Tree shakers and mechanical rakes can also be used when harvesting olives for oil. ...

Еще в разделе: (Показать все результаты (>1372) - herba.msu.ru/ )

• What's new?
• Insect catching and carnivorous plants
• Systema Naturae

... Gas bubbles in living tissues, when subjected to therapeutic ultrasound (TUS), may be found in relatively large cavities such as blood vessels, in intercellular spaces and within cells. ... For greater TUS intensity, when bubble might collapse near a surface, we study bubble behavior in confined space that simulates a tiny cavity such as intercellular space. ... In some cases, the bubble divides into two symmetrical bubbles that collapse while high velocity jets are generated, aiming at the walls. ...

Еще в разделе: (Показать все результаты (>215) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics and Flows, Instabilities, Turbulence, and
• ISNA-16
• Schedule : Nonlinear Acoustics of the Atmosphere, the Ocean, and the Earth

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>691) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>18) - www.ecocoop.ru/ )

Stephen Price (Southampton U) Q: The difference of theoretical and experimental patterns is rather high, why? The difference between the experimental and theoretical patterns is large in the case of the Cu and Pd EXAFS because only the first nearest neighbour shell is fit, that only the atoms within 3 е of the absorber. In contrast, the Au EXAFS is fit up to 6 е and so the theoretical and experimental patterns is much less. ... Q: What was the technology of underpotential deposition? ...

Еще в разделе: (Показать все результаты (>19) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/nazmutdinov.pdf

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>89) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, R.Stepanov, T.G.Arshakian, R. Beck, M.Krause, D.Sokoloff, Multiscale

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... UFFO . ... October 9, 2011 . The ?Lomonosov? project was presented at the Russian Science Festeval. ... The connecting operation between the scientific equipment of the Lomonosov project and scientific telemetric system was started at joint stock company ?Russian Space Systems?. ... The flying model of UFFO device has arrived. ... The ?Lomonosov? project was presented at the international aerospace show MAKS 2011. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• Publications | Университетский спутник "Ломоносов"