... public package Foswiki::Time . ... Time handling functions. ... Handles the following formats: Default Foswiki format . ... formatString Foswiki time date format, default $day $month $year - $hour:$min . ... Convert string representing a time interval to a pair of integers representing the amount of seconds since epoch for the start and end extremes of the time interval. $szInterval - time interval string . ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc...

Еще в разделе: (Показать все результаты (>4742) - wiki.cmc.msu.ru/ )

• TimeSpecifications < System < Foswiki

... Carnosine protects neurons against oxidative stress and modulates the time profile of MAPK cascade signaling. ... Using the model of ligand-dependent oxidative stress in neurons, we have shown that homocysteine (HC) initiates long-term activation of extracellular signal regulated kinase, isoforms 1 and 2 (ERK 1/2) and Jun N-terminal kinase (JNK) which corresponds to exitotoxic effect resulting in cellular death. ...

Еще в разделе: (Показать все результаты (>186) - biochem.bio.msu.ru/ )

Поиск по МГУ | Лента новостей | ... Университет . ... The Times исключил МГУ имени Ломоносова из списка ведущих Университетов мира . ... MsuNews.Ru . Московский государственный университет им. М. В. Ломоносова, впервые за последние годы оказался за пределами списка 200 ведущих ВУЗов мира, ежегодно составляемого британской газетой The Times. ... Информационно-новостной портал Новости МГУ имени М.В. Ломоносова поздравляет Виктора Антоновича с Днем рождения и желает ему крепкого здоровья . ...

Еще в разделе: (Показать все результаты (>456) - www.msunews.ru/ )

• MsuNews.Ru | Новости МГУ | Московский университет имени М.В. Ломоносова покинул
• MsuNews.Ru | Новости МГУ | Московский государственный университет имени М.В.
• MsuNews.Ru | Новости МГУ | Ректор МГУ имени М.В. Ломоносова просит вузы

... On the Institute . ... Development of relational methods of studying time [Chief: V.V. Aristov, Dr. Sci. (physics and mathematics)] . ... Physics of relic radiation, fundamental interaction mediator, carrier of space and time [Chief: I.M. Dmitrievsky, PhD (technology), Ass. ... Algebraic structure of space-time, algebrodynamics of fields and particles [Chief: V.V. Kassandrov, PhD (physics and mathematics)] . ... Causal mechanics [Chief: S.M. Korotaev, Dr. Sci. (physics and mathematics)] . ...

Еще в разделе: (Показать все результаты (>34) - temporology.bio.msu.ru/ )

• Зал искусств

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... About Faculty . ... Field stations . Faculty branches . ... Education . Undergraduate study . ... Type of field courses . ... Part-time courses (continuing education) aim to upgrade students qualifications, to enlarge professional attainments and experiences. ... The most distinctive features of part-time courses offered by the Faculty are as follows: . ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Everything You At any time Needed Or Ess . ... All You Need To http://www.thetonebigot.com Know About Present day Pay Day Loans . ... However, payday loans enable you to to deal with some monetary troubles without delay. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>6670) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: times Wuhan (2012), through tax
• Экологический Форум - Фундаментальная Экология: is Edit consumers times "strong
• Экологический Форум - Фундаментальная Экология: Rare at took billion. times

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . Run Time: 0.000535 . Select Type . ... Type . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>27) - osk.msu.ru/ )

• http://osk.msu.ru/forum/forums/faq.8/?_debug=1
• http://osk.msu.ru/forum/members/aaplicagf.1452/?_debug=1
• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1

... Preferences . ... Date & Time . ... Time zone: Default time zone Africa /Abidjan Africa /Accra Africa /Addis_Ababa Africa /Algiers Africa /Asmara Africa /Bamako Africa /Bangui Africa /Banjul Africa /Bissau Africa /Blantyre Africa /Brazzaville Africa /Bujumbura Africa /Cairo Africa /Casablanca Africa /Ceuta Africa /Conakry Africa /Dakar Africa /Dar_es_Salaam Africa /Djibouti Africa /Douala ... Note: Universal Co-ordinated Time (UTC) is also known as Greenwich Mean Time (GMT). ...

Еще в разделе: (Показать все результаты (>1457) - kodomo.cmm.msu.ru/ )

• Preferences: Date & Time тАУ Petri Dish
• Preferences: Date & Time тАУ Cyclyc Cell Automata
• Preferences: Date & Time тАУ Python Battle

предыдущий раздел] . ... Это связано с тем, например, что при низких температурах твердый раствор с х>0 более стабилен по сравнению с фазой NdBa 2 Cu 3 O z : NdBa 2 Cu 3 O z + O 2 Nd 1+x Ba 2-x Cu 3 O z + BaCuO 2 . ... Даже кратковременного отжига при оптимальных температурах 980-1030њС на воздухе достаточно , чтобы достичь Тс=92-94К. В то же время, отжиг в течение даже 60-100 ч. При 900њС приводит в конечном итоге к значениям Тс не выше ... Вебдизайн: Copyright (C) И. Миняйлова и В. Миняйлов . ...

Еще в разделе: (Показать все результаты (>2415) - chem.msu.ru/ )

• Time-of-flight mass spectroscopy detection of new elemental and mixed small
• Real-time dynamics in atoms and molecules: Fractional revivals of wave packets
• N.A. Chumakova

... Эпоха наполеоновских войн, Отечественной войны 1812 года поставила перед русским обществом вопрос о выборе исторического пути России, о ее месте в европейской истории. ... Проблемы эти возникали уже в XVIII столетии, когда пробуждение национального самосознания в России проходило на фоне тревохных событий во Франции. ... Russian society and national origin's problem at the time of napoleonic wars/ . Mirzoev E.B. (Moscow State University, Department of History) . ...

Еще в разделе: (Показать все результаты (>568) - hist.msu.ru/ )

• International Summer School 2011 "Russian History and modernity: the
• Материалы Тегеранской конференции 1943 г. Электронная библиотека исторического
• Виртуальные реконструкции городов Древнего мира

The abstract must not exceed one page. The electronic version must be sent to gertsens@imec.msu.ru . Abstract example . ... Paper example . Для выпуска сборника тезисов просьба выслать до одной страницы текста, предпочтительно набранного в формате Word со следующими параметрами: . Основной текст - Times New Roman Cyr, размер шрифта - 10. Название - Times New Roman Cyr, полужирный, буквы заглавные, размер шрифта - 11. ... Материалы следует выслать по адресу: gertsens@imec.msu.ru ...

Еще в разделе: (Показать все результаты (>41) - hit-conf.imec.msu.ru/ )

• Thesesses

... Asn Pro Ser Ser Leu .. ... CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN CYB5_CHICK CYB5_HUMAN 1 MVGSSEAGGEAWRGRYYRLEEVQKHNNSQSTWIIVHHRIYDITKFLDEHP .: ... HUMAN , MOUSE } vs { CAEEL , PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL } vs { PROWI , MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI } vs { MARPO , BRANA , VICFA } { HUMAN , MOUSE , CAEEL , PROWI , MARPO } vs { BRANA , VICFA } HUMAN + + + + MOUSE + + + + CAEEL + + + VICFA - BRANA - MARPO + ...

Еще в разделе: (Показать все результаты (>10864) - kodomo.fbb.msu.ru/ )

• Preferences: Date & Time тАУ Tanchiki
• Preferences: Date & Time тАУ Cyclyc Cell Automata
• Preferences: Date & Time тАУ Python Battle

This file is encoded in UTF-8 ; [Fonts] iso-2022-jp = shift_jis x-euc-jp = shift_jis shift-jis = shift_jis x-sjis = shift_jis euc-kr = ks_c_5601-1987 shift_jis , ARIAL = яМ-яМГ яМАу?Ду?Зу??у?? shift_jis , ARIAL BLACK = яМ-яМГ яМАу?Ду?Зу??у?? shift_jis , ARIAL NARROW = яМ-яМГ яМАу?Ду?Зу??у?? shift_jis , ARIAL ROUNDED MT BOLD = яМ-яМГ яМАу?Ду?Зу??у?? shift_jis , BOOK ANTIQUA = ...

Еще в разделе: (Показать все результаты (>85) - genphys.phys.msu.su/ )

• Микромаг - сервер

... Along with the stable inner proton belt, temporal variations of the 1-15 MeV protons at L=2.5-3.5 have been reported, with intensity increases and decreases registered during and after strong magnetic storms. ... Our study presents experimental evidences that creation and destruction of solar proton belts in the inner magnetosphere may be produced by the fast shifts of the proton penetration boundary without additional acceleration and injection. ... Black line shows the 50-90 MeV proton profiles. ...

Еще в разделе: (Показать все результаты (>271) - www.kosmofizika.ru/ )

• МИРОВОЕ ВРЕМЯ
• IMAGE-FUV, October 2003 Storm

... Scientific laboratories . ... Contact information . ... nazarov@cs.msu.ru . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, room 586 . ... Introduction to mathematical analysis of financial instruments by Dr. Doynikov, 32 lecture hours, 7th semester. ... The Laboratory operates a range of special courses in mathematical finance, including ?Introduction to mathematical analysis of financial instruments? and ?Mathematical models of financial instruments?. ...

Еще в разделе: (Показать все результаты (>159) - en.cs.msu.ru/ )

• Laboratory of Statistical Analysis
• Laboratory of Programming Technologies

... Submit your article . ... The article discusses materials of the newspaper The Times , which reflect the events of the governmental crisis in 1911. This crisis was caused by disputes over the introduction of the Zemstvo law in the South-western provinces with division of voters on a national basis. The bill passed the Duma, but it was rejected by the Council of the Empire. ... Zemstvo, The South-western provinces, Zemstvo bill, governmental crisis 1911, Stolypin, The Times . ...

Еще в разделе: (Показать все результаты (>569) - ee-journal.spa.msu.ru/ )

... Обучение . ... Помощь школе . ... Проводится запись на очные курсы СУНЦ МГУ на 2011-12 учебный год . ... 08.12.2012 День рождения школы . ... 12.02.2012 Интернет-олимпиада университетских школ . ... СУНЦ МГУ школа им. А.Н.Колмогорова . ...

Еще в разделе: (Показать все результаты (>690) - www.pms.ru/ )

This module provides for the generation of Expires HTTP headers according to user-specified criteria. ... This module controls the setting of the Expires HTTP header in server responses. The expiration date can set to be relative to either the time the source file was last modified, or to the time of the client access. ... ExpiresByType . ExpiresDefault . The ExpiresDefault and ExpiresByType directives can also be defined in a more readable syntax of the form: . ... Module: mod_expires . ...

Еще в разделе: (Показать все результаты (>71) - neptun.sai.msu.ru/ )

• Manual Page: rotatelogs - Apache HTTP Server
• Starting Apache
• MS Windows Netscape 3.0b4 KeepAlive problem solved

... Preferences . ... Date & Time . ... Time zone: Default time zone Africa /Abidjan Africa /Accra Africa /Addis_Ababa Africa /Algiers Africa /Asmara Africa /Bamako Africa /Bangui Africa /Banjul Africa /Bissau Africa /Blantyre Africa /Brazzaville Africa /Bujumbura Africa /Cairo Africa /Casablanca Africa /Ceuta Africa /Conakry Africa /Dakar Africa /Dar_es_Salaam Africa /Djibouti Africa /Douala ... Note: Universal Co-ordinated Time (UTC) is also known as Greenwich Mean Time (GMT). ...

Еще в разделе: (Показать все результаты (>163) - kodomo.cmm.msu.su/ )

• Preferences: Date & Time тАУ Petri Dish
• Preferences: Date & Time тАУ Cyclyc Cell Automata
• Preferences: Date & Time тАУ Python Battle

... Revision of the Geological Time Scale; Implications for the "Quaternary" . The International Commission on Stratigraphy (ICS) intends to extend the Neogene System to the present and eliminate Quaternary as a formal chronostratigraphic . ... INQUA insists that "Quaternary" be retained as a formal unit in the new Geological Time Scale. ... INQUA recommends that ICS formally adopt Brad Pillans' proposal that the Quaternary be a formal Subsystem of the Neogene, extending from the beginning of . ...

Еще в разделе: (Показать все результаты (>136) - www.fadr.msu.ru/ )

• Created with DiDa
• "EcoPhoto" Image archive - Contacts
• Foundation for Agrarian Development Research - Web-development