This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>108) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_negotiation
• Manual Page: rotatelogs - Apache HTTP Server

... Now let us consider that damping or amplitude of the signal like a natural index of a hypothetical inequality or mean between the action and reaction, or the kinetic and the potential energy of the system. The time between the action and the reaction must be different from zero. ... We can describe this behaviour in its simpler form by the oscillation of a balance with inertiality or sensitivity, that is to say, with a time of reaction for the operations of adding or removing weights. ...

Еще в разделе: (Показать все результаты (>371) - chronos.msu.ru/ )

• Laboratory-chair of Discrete mechanics on a microscopic scale
• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Biology Direct | Full text | Erwin Schroedinger, Francis Crick and epigenetic

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>77) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Homepage.

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>34) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Kazakevich, Olga [Казакевич О.А.]. Aspect in Selkup and Evenki: searching for a

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>7) - tex.bog.msu.ru/ )

... News . ... The major part of the course is dedicated to the studying measuring devices and units for data collection and processing, re-engineering of unknown circuits. ... Programming an unknown board on TestVue Software . ... Functional testing of an unknown board; comparison with the pattern . ... Working on a course project: testing of a board or a device with unknown malfunctioning, faultfinding and debugging, demonstration of the functioning device. ... 2013-2015 Engineering Physics Laboratory...

Еще в разделе: (Показать все результаты (>20) - engineering.phys.msu.ru/ )

• Parallel Programming
• Introduction to Linux
• Noise Meter

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>300) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SDP home page

... Standard MP4 benchmark . ... Press to visit Firefly version 8.0.0 beta Intel AVX-enabled Core i7 2600K benchmarks page . ... Press to visit PC GAMESS/Firefly version 7.1.F Core i7 940 benchmarks page (Windows 64-bit, HTT and Turbo Boost Technology enabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core i7 benchmarks page (Linux 64-bit, HTT and Turbo Boost Technology disabled) . Press to visit PC GAMESS/Firefly version 7.1.E Core 2 Quadro Q9550 (Yorkfield) benchmarks page . ...

Еще в разделе: (Показать все результаты (>97) - classic.chem.msu.su/ )

• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Not kidding at all: PC GAMESS/Firefly v. 7.1.E benchmarks on Intel Core

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>59) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... education . ... Functional Nanomaterials . ... Composite Nanomaterials Master?s Program . ... admission in January 2010 . ... MSU Faculty of Chemistry announces a new Master?s Program in Composite Nanomaterials, 510500 Chemistry. The program is under the aegis of MSU Nanotechnology Education and Research Center. ... The program is aimed mainly at graduates and young scientists, including Candidates of Science, in chemistry or physics (additional higher education.) ...

Еще в разделе: (Показать все результаты (>13) - nano.msu.ru/ )

• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>17) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>135) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• RNA Kinetics main page

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>73) - qilab.phys.msu.ru/ )

... Measurement of the MASS detectors parameters with mass program January 24, 2015 [112707] . MASS/DIMM electronics. ... Turbina-core(D): Dimm User Guide. ... N.Shatsky, V.Kornilov, The revision of the MASS/DIMM star catalogue. ... О.Возякова, В.Корнилов, Н.Шатский, Новое программное обеспечение прибора MASS/DIMM. ... V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site. ...

Еще в разделе: (Показать все результаты (>26) - curl.sai.msu.ru/ )

Development of new approaches to the analysis of ring shapes in organic molecules and the description of electronic distribution (atomic charges) and halogen bonding in the framework of forcefield model for rapid estimation of intra- and intermolecular interaction energies in molecular mechanics, molecular dynamics and docking methods . Forcefield is a model and a set of parameters for theoretical description of intra- and intermolecular interactions. ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>3) - qsar.chem.msu.ru/ )

... Identification of Nonlinear Behavior of Soils in Strong Earthquakes . ... The purpose of the study is quantitative description, in terms of higher-order transfer functions, of the nonlinear soil behavior in strong earthquakes. Records of strong earthquakes, provided by seismic vertical arrays, represent valuable experimental data, allowing estimation of the soil behavior at different depths. ...

Еще в разделе: (Показать все результаты (>86) - acs366.phys.msu.su/ )

• Abstract (Invited)

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Sofiev M. , Siljamo P. , Ranta H. , Linkosalo T. , Jaeger S. , Rasmussen A. , Rantio-Lehtimaki A. , Severova E. , Kukkonen J. в журнале International Journal of Biometeorology , издательство Springer Verlag (Germany) , том 57, ? ...

Еще в разделе: (Показать все результаты (>776) - istina.msu.ru/ )

• Sofiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Natural product communications - журнал | ИСТИНА - Интеллектуальная Система
• Forest Products Journal - журнал | ИСТИНА - Интеллектуальная Система