Prague, August 16, 2006 . Our trial revision of the GCVS data for several southern constellations show that type changes are not needed for most stars. ... We suggest to add one more symbol combining types, in the cases when two or more classification options remain for the same star, for example, EC|Ell, EC|RR (here EC means a contact eclipsing binary, this is one of our suggestions from next slides). ... Moreover, it will simplify moving stars from the suspected-variable catalogue to the GCVS. ...

Еще в разделе: (Показать все результаты (>77) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Description

The laboratory is engaged in fabricating high-efficiency catalysts and working out model descriptions of kinetics and mechanisms of the processes which take place in chemical power sources. The electrochemical techniques of catalysts preparation aimed to obtaining microloadings of platinum metals are developed, and the approaches to the regulating of the quantity and dispersion of deposited metal (by means of varying the support type, deposition potential, electrolyte composition, etc) are found. ...

Еще в разделе: (Показать все результаты (>55) - electr003.chem.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>83) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Moss D., Sokoloff D., Resonances for activity waves in spherical mean field

... News . ... The major part of the course is dedicated to the studying measuring devices and units for data collection and processing, re-engineering of unknown circuits. ... Programming an unknown board on TestVue Software . ... Functional testing of an unknown board; comparison with the pattern . ... Working on a course project: testing of a board or a device with unknown malfunctioning, faultfinding and debugging, demonstration of the functioning device. ... 2013-2015 Engineering Physics Laboratory...

Еще в разделе: (Показать все результаты (>20) - engineering.phys.msu.ru/ )

• Parallel Programming
• Introduction to Linux
• Noise Meter

... Generation of recombinant antibodies and means for increasing their affinity. ... For example, application of recombinant technologies resulted in antibody preparation of high affinity significantly exceeding the initial affinity of natural antibodies. In this review we summarize information about the structure, modes of preparation, and application of recombinant antibodies and their fragments and also consider the main approaches used to increase antibody affinity. ...

Еще в разделе: (Показать все результаты (>25) - biochem.bio.msu.ru/ )

... Improvement of Methods and Means of Nonlinear Acoustics for Diagnostics of Concrete of Massive Items, Constructions and Structures . ... For want of distribution of elastic waves in a medium have heterogeneity (located defects, stratification, crack) the performances of an information signal, for example, velocity of distribution, amplitude, spectral component can change the parameters [1]. ... These performances are treated on the specially developed algorithm. ...

Еще в разделе: (Показать все результаты (>121) - acs366.phys.msu.su/ )

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1312) - swx.sinp.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>60) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>15) - comphep.sinp.msu.ru/ )

• extra:main [CompHEP]
• extra:model:main [CompHEP]

Photoluminescence quenching in blends of conjugated polymer with low-molecular acceptors Graduate work of the 6 year student of the Chamber of General Physics and W ave Process Yu.V.Krylova Annotation This graduate work covers rightness of description photoluminescence quenching process (in blends of conjugated polymer MEH-PPV (poly[2-methoxy-5-(2`-ethylhexyloxy)-1,4-phenylene vinylene) with different types of low ... It makes absorption in the field of CP high-luminescence stronger. ...

Еще в разделе: (Показать все результаты (>81) - ofvp.phys.msu.ru/ )

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>4) - tex.bog.msu.ru/ )

Exciplexes on INTERNET . http://www.syp.toppan.co.jp:8082/6606/N5019/KEN5019M01.html . ... last fetched: 02-Jun-95 . bytes: 24034 . ... bytes: 7133 . ... outline: Computational Chemistry Research Computer Programs: Send a message. keys: exciplex . excerpt: Don Truhlar's Home Page Computational Chemistry Research Research Program Summary: Our research group is carrying out theoretical and computational studies of chemical reaction dynamics, molecular energy transfer, and molecular modeling. ...

Еще в разделе: (Показать все результаты (>382) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)
• Client-side Clickable Image Example
• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 226 (2008)

Setting Up a Pay System Canada Business Service Centres - CBSCs Last Verified: 2004-05-28 Document No. 4046 Summary Pay administration is a management tool that enables you to control personnel cost, increase employee morale, and reduce work force turnover. ... This publication provides time-tested concepts for determining competitive pay levels and for maintaining fair pay relationships among the jobs comprising a small company. ... appraise employee performance under the plan. ... job title; . ...

Еще в разделе: (Показать все результаты (>16) - innovation.msu.ru/ )

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>13) - nano.msu.ru/ )

• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and
• Announcement about the admission to MSU Graduate School for a new Master?s

Lomonosov Moscow State University . ... Academic Programs . ... Academic Departments Programs . ... Russian Language Program . ... There is a well-known fact that if one doesn't know any foreign languages, he has no notion about his mother tongue. ... Moreover, the academic content is connected with the creation of texts in the Russian language relevant to a plan of a speaker and a writer. ... Address: MSU, Faculty of Foreign Languages and Area Studies, Russia, 119192, Moscow, 31/1, rooms 234-235 . ...

Еще в разделе: (Показать все результаты (>55) - ffl.msu.ru/ )

. [ Войти ] . Главная -> Фильмы -> The Meaning of Life . Пользователи . Демо . Деньги . Фильмы . Форум . The Meaning of Life . США 2005 . отметить . Мультфильм . Фантастика . Драма . Музыкальный . Don Hertzfeldt . Nicole Gabriella Scipione . Robert May . Kinsey Packard . Karin Anger . Sara Cushman . Jennifer Nyholm . Don Hertzfeldt . June Shields . Noah Harpster . Kenneth Cook .

Еще в разделе: (Показать все результаты (>171) - kinfo.ru/ )

• Mean Girls - Фильмы - Kinfo.ru
• Mean Dog Blues - Фильмы - Kinfo.ru
• Men of Means - Фильмы - Kinfo.ru

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>73) - qilab.phys.msu.ru/ )