Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>140) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks2011/asymbrane_QFTHEP11.pdf
• http://qfthep.sinp.msu.ru/talks/kinks1.pdf

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>350) - chronos.msu.ru/ )

• Historical events as manifestations of time
• On the Way to Understanding the Time Phenomenon: the Constructions of Time in

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>44) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>118) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 4/2014

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>13) - antares.sinp.msu.ru/ )

Application of the Quickhull algorithm's principles to the double description method" . Bastrakov S.I., Zolotykh N.Yu. The double description method known also as the Motzkin-Burger algorithm is a method for computing the general solution of a system of linear inequalities. ... The numerical results demonstrate a number of advantages of the proposed modification over the original double description method and (in many cases) over the Quickhull algorithm. ... PostScript (in Russian) (1.51MB) . ...

Еще в разделе: (Показать все результаты (>183) - num-meth.srcc.msu.ru/ )

• "TreeDL: a language for description of graph structures and operations on them"
• "Automatic detection and description of supercomputer network infrastructure"
• "General description of subroutines for solving ordinary differential equations

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>299) - higeom.math.msu.su/ )

• C*-algebras: Talks

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>458) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Описание экскурсии на гору Малая Куртяжная.

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>1238) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SCOP famyli:
• SDP home page

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_negotiation
• Manual Page: rotatelogs - Apache HTTP Server

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>53) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>75) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).

Exciplexes on INTERNET . http://www.syp.toppan.co.jp:8082/6606/N5019/KEN5019M01.html . ... last fetched: 02-Jun-95 . bytes: 24034 . ... bytes: 7133 . ... outline: Computational Chemistry Research Computer Programs: Send a message. keys: exciplex . excerpt: Don Truhlar's Home Page Computational Chemistry Research Research Program Summary: Our research group is carrying out theoretical and computational studies of chemical reaction dynamics, molecular energy transfer, and molecular modeling. ...

Еще в разделе: (Показать все результаты (>323) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)
• Client-side Clickable Image Example
• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 226 (2008)

. Name . Last modified . Size . Description . Parent Directory . - . next.gif . 19-Jan-2010 19:54 . 116 . prev.gif . 19-Jan-2010 19:54 . 116 . rtop.gif . 19-Jan-2010 19:54 . 896 . Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80

Еще в разделе: (Показать все результаты (>202) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr09_files
• Index of /sinp/panasyuk/cr11_files

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: on the will example, refine wealth, the a . ... a href=http://celineforyou.zohosites.com/><b>Celine bags</b></a> As we all know, buy things online maybe cheaper than absolute shopping, so abounding women like online shopping. ... http://www.isabelmarantmybest.com . ...

Еще в разделе: (Показать все результаты (>3083) - www.sevin.ru/ )

• A.N. Severtsov Institute of Ecology and Evolution (IPEE RAS): Site News: Site
• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Экологический Форум - Фундаментальная Экология: shall year June best example,

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

... Nonlinear Acoustic Waves Description by Exact Solutions of Modulation Equations . ... Exact solutions of some nonlinear modulation equations (Nonlinear Schrodinger equation, Coupled Schrodinger equations, Ginzburg-Landau equation) are obtained in an explicit form. ... The modulation equations govern finite-amplitude acoustic waves evolution in various wave-guides, in particular, in layered media. The profiles of their exact solutions are very similar to that observed recently in experiments [1,2]. ...

Еще в разделе: (Показать все результаты (>94) - acs366.phys.msu.su/ )

• AUTHOR : Porubov A

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1229) - swx.sinp.msu.ru/ )