... General Contraction (GC) i=j cijxkylzmexp(-jr2) common set of exponents within each shell type (very) long expansions Examples: Roos' ANO, Dunning's cc-pVXZ (to some degree) Standard Direct Fock matrix formation code loop over all shells (P index) loop over Q P, Q in P domain loop over all shells (R index) · loop over S R, S in R domain Check (PQ|RS) using selection criterion Calculate non-negligible (PQ|RS) if any Add their contributions ...

Еще в разделе: (Показать все результаты (>58) - classic.chem.msu.su/ )

• Lesson 3: two methods for preparing Firefly' input files with basis sets and
• PC GAMESS/Firefly DOCUMENTATION - Potential Energy Surface (PES) scan features

... All Morphological filters are based on two operations -- dilation and erosion . ... It is common to call in the above expressions as an image, and as a structural element. The surface plays the role of the image in the morphological filters used in FemtoScan program (lets define it as ), while the object (shown below) most often plays the role of structural element. ... Filter . ... The filter fulfill the operation erosion over the current image using a selected tip as a structural element. ...

Еще в разделе: (Показать все результаты (>39) - www.spm.genebee.msu.ru/ )

• DSP board program
• Threshold filtering
• Highlight

О лаборатории . ... Лаборатория теоретической биофизики . ... continue reading..... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>27) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• Using RESP with GAMESS-US and Firefly (PC-GAMESS) ERG Research Group:
• Visual approach to construction of &QMMM section of CP2K input file ERG

... The laboratory of enzymatic modifi-cation of physiologically active compounds (Dr. V.K.Svedas) is dealing with kinetic and thermodynamic regularities of enzymatic hy-drolysis and synthesis of -lactam antibiotics, N-acylated amino acids and their analogues as well as with specificity and stereospecificity of different amidohydrolases. ... The research group of Dr. P.V.Vrzhesch deals with the study of cell re-sponse regulation by the example of aggrega-tion of blood platelets. ... 1997). ...

Еще в разделе: (Показать все результаты (>108) - www.genebee.msu.ru/ )

... Please retype /font /b /td /tr % } tr td class = form nbsp; b Your name: /b /td td class =formi input type=text size= 60 value= %$ author % name= author /td /tr tr td class = form nbsp; b Your e-Mail: /b /td td class =formi input type=text size= 60 value= %$ dbh->quote($author) . ... br>"); return -1; } my $last_id=DB_functions::get_max_id($dbh,$tree,'id'); my $parent = ($id>0)?$id:0; if (!$dbh->do("INSERT INTO $tree (id,parent,resource) VALUES ( $last_id," . ...

Еще в разделе: (Показать все результаты (>36) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/includes/forum/showmessage.msn

The quantitative probabilistic model of the solar energetic particle fluxes description . ... Notice : Undefined index : ion_spectra in / home / swx / public_html / models / database / modules / prog.php on line 152 Notice : Undefined index : MNX in / home / swx / public_html / models / database / modules / prog.php on line 153 Notice : Undefined index : NPB in / home / swx / public_html / models / database / modules / prog.php on ...

Еще в разделе: (Показать все результаты (>12) - swx.sinp.msu.ru/ )

• http://swx.sinp.msu.ru/models/database/modules/prog2.php
• http://swx.sinp.msu.ru/models/database/modules/smdc-prog.php
• http://swx.sinp.msu.ru/models/ch_area.php

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>17) - cdfe.sinp.msu.ru/ )

... COLAMO [1] . Fire!Constructor [2], . ... Fire!Constructor ( Include COLAMO). ... 4 - Fire!Constructor COLAMO - ARGUS. ... ARGUS : Define N = 5; Define K = 6; Define M = 1; DMC[0.A] # Metka : Read A step M repeat K; Add A, K; Loop N Goto Metka; DMC[0.C] # Metka1 : Read C step M repeat K; Add C, K; Loop N Goto Metka1; DMC[0.D] # Metka2 : Read D step M repeat K; Add D, K; Loop N Goto Metka2; DMC[0.B] # Metka3 : Write B step M repeat K; Add B, K; Loop N Goto Metka3; Read ­ , (.. ...

Еще в разделе: (Показать все результаты (>5) - fpga.parallel.ru/ )

... 8 OpenFlow , , , , , , NAT, ARP, DNS, DHCP, BGP , , web · ­ · events per second · >10M · "" ­ · us · ­ 24/7 · ­ : ­ (2013) · · · · · · · · · NOX-Classic NOX Beacon Floodlight SNAC Ryu POX Maestro Trema · · · · · · · · · Helios FlowER MUL McNettle NodeFlow Onix SOX Kandoo Jaxon · Cisco ONE controller · Nicira NVP Controller · Big Network Controller · IBM Programmable Network Controller · HP SDN Controller · NEC Programmable Flow 11 · ­ ­ · ­ · ­ · ­ OpenFlow 12 5/30/2013 13 (2013) · 7 000 000 . ...

Еще в разделе: (Показать все результаты (>5) - lvk.cs.msu.su/ )

Your Marketing Strategy Canada Business Service Centres - CBSCs 1. ... List your service(s) or product(s) . ... Personal Selling o Evaluate Media, Vehicles (Strengths/Weaknesses) o Target Market Analysis o Cost Advertising o Which media best reaches your customers? o When should you advertise? o How much should you spend? o How often should you advertise? o What should you advertise? o Cost/Benefit analysis Sales Promotion o What type of sales promotion should you do? o What form should it take? ...

Еще в разделе: (Показать все результаты (>15) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/marketingplanoutline.doc

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>116) - lnfm1.sai.msu.ru/ )

• Астрономическое отделение Физического факультета МГУ им.Ломоносова - Кафедры

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . Filter is intended for reconstructing panorama of scene by movie. ... The work of MSU Panorama is based on motion vectors. ... MSU Panorama has two processing modes: . ... Example of panorama for ''stefan'' movie . full size image . One more example of MSU Panorama for two processing modes. Example of panorama for ''bus'' movie . ... video@graphics.cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>172) - graphics.cs.msu.ru/ )

• Building panorama image from video | Лаборатория компьютерной графики и
• Removing of blocking effect from video | Graphics and Media Lab
• Removing of blocking effect from video | Лаборатория компьютерной графики и

... 2015 . ... Submit your article . ... Assistant professor, School of Public Administration, Lomonosov Moscow State University. ... The article reveals the main trends in higher education related to its growth, the internationalization of labor market and educational services market, etc., leading to a change in forms of state regulation. ... Educational Services Market, Labor Market, Educational System, Public Administration. ... Public Administrarion". ... Copyright ї 2015 SPA MSU . ...

Еще в разделе: (Показать все результаты (>109) - ee-journal.spa.msu.ru/ )

Notice : Undefined index: idf in W:\Apache\wwwEnzyme\efremenko\ref.php on line 19 . Notice : Undefined variable: File in W:\Apache\wwwEnzyme\efremenko\ref.php on line 70 . ... Warning : fclose(): supplied argument is not a valid stream resource in W:\Apache\wwwEnzyme\efremenko\ref.php on line 72 . Laboratory of Ecobiocatalysis . ... Head of the laboratory: Ph.D., D.Sc., prof. Efremenko Elena N. Affiliation and official address: . ... E-mail: efremenko@enzyme.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>45) - www.enzyme.chem.msu.ru/ )

• PubMed medline query

setup-gsi: Configuring GSI security Installing /etc/grid-security/certificates//grid-security.conf.42864e48.. Running grid-security-config.. G S I : C O N F I G U R A T I O N P R O C E D U R E Before you use the Grid Security Infrastructure, you should first define the DN (distinguished name) that should be used for your organization's X509 certificates. ... Installing Globus CA signing policy into trusted CA certificate directory... setup-gsi: Complete ...

Еще в разделе: (Показать все результаты (>7) - lhe.sinp.msu.ru/ )

Academic English English for Students of Mathematics and Mechanics Supplementary Exercises Part II L.N.Vygonskaya O.Y.Sviridenko MSU Moscow 2012 Academic English (part 2 of 4) The tasks are based on «English for Students of Mathematics and Mechanics» by Y.I. Mindeli. Unit 1 Task 18. ... 1 Armer, T. Cambridge English for Scientists, Cambridge, 2011 4 Academic English (part 2 of 4) Unit 7 Midterm test Unit 8 (At home) Make up a list of linking words you know and bring it to class. ... Task 15 p.93. ...

Еще в разделе: (Показать все результаты (>16) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/Academic_English_part3.pdf

... Часть 1 . ... C-DVM - часть 3 . ... Матрица коэффициентов А размещена в секции массива А[0: N-1 ][0: N-1 ], а вектор В в секции этого же массива A[0: N-1 ][N]. /* программа GAUSS */ #include math.h # define DVM (dvmdir) # define DO(v,l,h,s) for(v=l; v =h; v+=s) # define N 100 main () { int i, j, k; /* описание динамических распределенных массивов */ DVM (DISTRIBUTE [BLOCK] []) float (*A)[N+1]; DVM (DISTRIBUTE [BLOCK]) ... рассылке i-ой строки всем процессорам в массив ROW. ...

Еще в разделе: (Показать все результаты (>104) - sp.cs.msu.ru/ )

• C-DVM language description. Part 3 (Apendixes)
• Prefictor of DVM-program performance. User's guide
• C-DVM language description. Part 1 (1 - 4)

... On-line консультант . ... Приглашаем всех, интересующихся исследованиями и разработками в области компьютерных сетей, принять участие в семинаре по software-defined networking, который состоится 4 июля 2011 (понедельник) в 19.30 в Политехническом музее (Новая площадь, д 34;, подъезд 9, малая аудитория). ... We are about to witness a revolution in the networking towards so-called "Software Defined Networking" (SDN). SDN enables innovation in all kinds of networks . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>3) - erp.cmc.msu.ru/ )

Regularization methods with set extension for solving unstable problems of minimization" . ... Some modifications of regularization methods for solving problems of minimization with inaccurate input data are proposed on the basis of the approach of set extension. ... This allows us to construct regularized problems from the same class the original problem belongs to. For example, if the original problem is a problem of linear programming, then the regularized problem are those from the same class. ...

Еще в разделе: (Показать все результаты (>125) - num-meth.srcc.msu.ru/ )

• Increasing the interval of convergence for a generalized Newton's method of
• "Application of the Monte Carlo method for estimating the total time of solving
• "On the quaternary coding of cubic structures"

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )