.

Еще в разделе: (Показать все результаты (>11) - www.chemport.ru/ )

Introduction Globus ToolkitTM Developer Tutorial The Globus ProjectTM Argonne National Laboratory USC Information Sciences Institute http://www.globus.org/ Copyright (c) 2002 University of Chicago and The University of Southern California. ... Detailed understanding of component functionality ­ Ability to combine components in useful ways l Provide in-depth discussions of the Globus Toolkit. ... March 25, 2002 Globus ToolkitTM Developer Tutorial: Introduction 7 ...

Еще в разделе: (Показать все результаты (>57) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/ososkov/ACATOsoskov.doc
• http://acat02.sinp.msu.ru/presentations/litinski/litinski.doc
• http://acat02.sinp.msu.ru/presentations/ohl/acat2002.pdf

... More Reports . ... Vocal repertoire in the Dhole Cuon alpinus in captivity // In: Canid Biology and Conservation, An International Conference, Oxford. Three independent structural components form the dhole vocal repertoire: the low tonal, the high tonal, and the pulsed one. On the base of the occurrence of the components the dhole vocal repertoire was represented as consisting of three vocal classes with eleven call types. ... Research * Student Reports . ...

Еще в разделе: (Показать все результаты (>33) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях

This module provides support for dynamically configured mass virtual hosting . ... Source File: mod_vhost_alias.c . ... For simple name-based virtual hosts you might use the following directives in your server configuration file: UseCanonicalName Off VirtualDocumentRoot /usr/local/apache/vhosts/%0 . A request for http://www.example.com/directory/file.html will be satisfied by the file /usr/local/apache/vhosts/www.example.com/directory/file.html . ... Module: mod_vhost_alias . ...

Еще в разделе: (Показать все результаты (>95) - neptun.sai.msu.ru/ )

• Apache module mod_example
• The Apache TPF Port
• Apache module mod_imap

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>32) - hpc.msu.ru/ )

• http://hpc.msu.ru/files/HPC/ISC_2015_Posters_submission_14.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>636) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• Example of supporting positions
• SCOP classification

... I mean the following Theorem If any local eld (x) is irreducible and [ (x), (y )] = B (x - y ), (1) then operator B (x) is multiple of unit operator, that is (x) is an asymptotic eld. ... Our result is most interesting in the case of noncommutative theory, precisely, in the case of space-space noncommutativity, in which time commutes with spatial variables and, as a consequence, one spatial variable, say x3, commutes with others. ... For simplicity we consider the case of neutral scalar elds. ...

Еще в разделе: (Показать все результаты (>140) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks2013/Exponen_decay_HEP_2013.pdf
• http://qfthep.sinp.msu.ru/talks2013/minnesota2013.pdf

... Screening by Keywords . Protein databanks . SWISSPROT protein databank TREMBL protein databank . ... Receive bank sequences . Yes No . Receive 3D coordinate . ... Query string You can use here any keywords and 'OR' , 'AND' and 'ANDNOT' logical operators. ... proteinase cleave . DE [proteinase] AND cleave (could be written as: DE [proteinase] cleave) . DE [proline] DE [aminopeptidase] ) OR ( KW [proteinase] DE [cleave] ) . XX[A$b5] ANDNOT cleave . ...

Еще в разделе: (Показать все результаты (>158) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

IMAGE SUPER-RESOLUTION USING FAST DECONVOLUTION A. Krylov2, A. Nasonov3, O. Ushmaev 2 4 1 Faculty of Computational Mathematics and Cybernetics, Moscow Lomonosov State University ... Informatics problems of the Russian Academy of sciences, 119333, Russia, Moscow, Vavilova, 44, 2, (499) 135-62-60, olegu@bliolink.ru Super-resolution problem is posed as an inverse deconvolution problem ... Hybrid method to suppress the problems of warping operator inaccurate determining is under work. ...

Еще в разделе: (Показать все результаты (>98) - imaging.cmc.msu.ru/ )

• Ringing analysis | Laboratory of Mathematical Methods of Image Processing

... Data . ... Projects . ... The data in this section is mirrored from NASA COHOWeb . ... This page was created with the kind help of Dr. Joseph H. King, NASA/NSSDC, who supplied OMNI and COHO data. ... Heliographic inertial longitude [degrees] . ... BX in SSE coordinate system [nanoteslas] . ... BR in RTN coordinate system [nanoteslas] . ... Plasma flow bulk velocity [km/s] . Plasma flow velocity vector elevation angle [degrees] . Plasma flow velocity vector azimuth angle [degrees] . ...

Еще в разделе: (Показать все результаты (>27) - smdc.sinp.msu.ru/ )

• IGRF10 model - Space monitoring data center
• Space monitoring data center

... QUANTUM INFORMATION AND COMPUTATION Absolute Robustness of the First Principal Fourier State Component and Noise Suppression in Hilbert Space Yu. ... 2, Moscow, 119992 Russia e-mail: skulik@qopt.phys.msu.su Received March 28, 2006 Abstract--The effect of the absolute robustness of the first principal Fourier-state component is developed upon rounding off the density matrix elements. ... This is interpreted as the absolute robustness of the first principal component of the Fourier state density...

Еще в разделе: (Показать все результаты (>72) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/papers/2013-njp-15-035012.pdf
• http://qi.phys.msu.ru/papers/2010-nphoton-4-585.pdf
• http://qi.phys.msu.su/papers/2006-prl-97-023602.pdf

... Key carbonatite localities that have been investigated as part of INTAS project 05-1000008-7938 ‘ Diamond and Graphite in Carbonate Magmas ’ are: (1) Western Greenland, where the distribution of kimberlites , lamproites and carbonatites is correlated with depth to a fossil subducted slab (personal communication, Nielsen 2008); (2) the Chagatai Complex of ... Generation of carbonatitic melt through partial melting of carbonated eclogite under mantle conditions. ...

Еще в разделе: (Показать все результаты (>296) - geo.web.ru/ )

• Trusov Sergey's homepage The influence of boundary layer effects on the melt
• Dictionary_V
• The influence of boundary layer effects on the melt inclusions compositions.

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>149) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 1/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

Canidae . ... Analysis of variation of the cheek teeth in three canid species (Mammalia: Canidae) by means of standard and geometric morphometrics Zoological Museum of Moscow University Several methods of minimizing size from overall variation are compared, which are shape variables of geometric morphometrics, two methods of data standardization (by character means and by specimen centroids), and principal component analysis. ... Rohlf, 1986; Bookstein, 1991; Navarro et al., ... 414 Canidae . ... Vol. ...

Еще в разделе: (Показать все результаты (>826) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of

... 2) to undertake multuaspectual reseach of textual and dictionary data using developing software, including combination and comparison of various classifications of textual and dictionary elements of Natural Language. Up to now in majority of cases systems for text processing, on the one hand, and systems for accumulation and analysis of dictionary data, on the other, are elaborated separately. ... It provides a user with ability to control and analyse some textual data. ...

Еще в разделе: (Показать все результаты (>47) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... PhDi . ... SOFTWARE PACKAGE FOR CALCULATIONS OF PHASE DIAGRAMS . elaborated and developed by laboratory scientists) . The software package contains a database of thermodynamic properties for about 200 systems and a software based on a so called convex hulls approach. ... binary systems in coordinates Temperature - Composition at fixed pressure and Pressure ? ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>8) - td.chem.msu.ru/ )

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>5) - lmmqsp.sinp.msu.ru/ )