... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: on the will example, refine wealth, the a . ... a href=http://celineforyou.zohosites.com/><b>Celine bags</b></a> As we all know, buy things online maybe cheaper than absolute shopping, so abounding women like online shopping. ... http://www.isabelmarantmybest.com . ...

Еще в разделе: (Показать все результаты (>4012) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Gucci the The example, people
• Экологический Форум - Фундаментальная Экология: example, level Chinese luxury
• Экологический Форум - Фундаментальная Экология: by way of a different...

... The main markers of reciprocity in Russian are the pronoun drug druga `each other' and the suffix - sja , which also has the reflexive, the anticausative and other meanings: celovat ' ` kiss smb' celovat '- sja / celovat ' drug druga ` kiss each other' (see also Knjazev 2007) The form of the pronoun drug ... This meaning of plural reciprocal situation seems to be strange: neither the suffix -sja, nor the pronoun drug druga expresses plurality by itself. ... Reciprocal...

Еще в разделе: (Показать все результаты (>283) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/mscl/abstracts/oskolskaya.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/kuznetsova.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf

The Converter of Measurement Units is aimed to converting of measurement units between different systems of measurement, for example from British-American units of measurement to metric system and vice versa. To convert a value . ... On the left panel list select a measure you want to convert . ... Select the measurement unit you want to convert from . ... Select the measurement unit you want to convert to . ... Result is displayed in the "Conversion Result" area. ...

Еще в разделе: (Показать все результаты (>12) - sbmg.geol.msu.ru/ )

... Surface and Curve data are saved using FemtoScan format. To save a file press button or choose menu command File/ Save . To save a file at different name choose menu command File/ Save As.. To save all new or revised files take menu command File/ Save All . ... It is possible to export images into text ASCII files, into the image Bitmap or Jpeg files, and also into 3D image file format used in Internet (VRML file format). ... Image Types . ... Export is done by menu command File/ Export . ...

Еще в разделе: (Показать все результаты (>120) - www.spm.genebee.msu.ru/ )

• Delete File
• Drawing Curves
• Server

Example of the Matrix of Size 6?6 with Different Tropical Rank and Kapranov Rank / Shitov Ya.N. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>81) - vestnik.math.msu.su/ )

cAMP-induced conformational changes of Protein Kinase A I A-domain O. N. Rogacheva, V. E. Stefanov St. Petersburg State University, Universitetskaya nab. ... In the end, we presented the conformational transition of the A-domain in the form of a partly deterministic sequence of six events: 1) B 2) C1, D1, 3) E, 4) C2[D2], F, 5) G. The sequence of the items of this scheme corresponds to the process of the conformational transition in time. ...

Еще в разделе: (Показать все результаты (>255) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/217.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/135.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/132.pdf

... We are pleased to inform you that Federation of European Societies of Plant Physiology (FESPP), Russian Academy of Sciences (RAS), Ministry of Education of Russian Federation, Division of Physico-Chemical Biology RAS, Russian Society of Plant Physiologists, Scientific Council of Plant Physiology and Photosynthesis RAS, K.A.Timiryazev Institute of Plant Physiology RAS and Russian Peoples' Friendship University are ... Lev N. Andreev (Moscow, Russia) . ... TUESDAY, OCTOBER, 23rd ...

Еще в разделе: (Показать все результаты (>193) - herba.msu.ru/ )

• Behaviour of white water-lily flowers in different photoperiods
• The variability of different Drosera
• The behavior of Nymphaea flowers

Dear State Exchange Members, . I wanted to let you know that we are in the process of transitioning to a new name and address for State Exchange. ... The new address will be https://alumni.state.gov , although the old address ( https://statexchange.state.gov ) will continue to work for many months to come. ... I also wanted to let you know that from July 21 to 25, I will be traveling to Minsk and Gomel, Belarus to meet with alumni. ... Hilary . ... https://statexchange.state.gov ...

Еще в разделе: (Показать все результаты (>129) - www.prof.msu.ru/ )

• Conflict Transformation, Ngo And Networking
• NGOs: The Carriers of Globalization?
• EurasiaNet Now Posting Articles in Russian

. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001

Еще в разделе: (Показать все результаты (>20) - www.rochesterastronomy.org/ )

... Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling pathways. ... Inhibition of rat neuronal Na(+)/K(+)-ATPase alpha3 isoform at low (100 nM) ouabain concentration led to activation of MAP kinase cascade via PKC and PIP(3) kinase. ... These data are the first demonstration showing participation of ouabain-resistant (alpha1) and ouabain-sensitive (alpha3) Na(+)/K(+)-ATPase isoforms in diverse signaling pathways in neuronal cells. ...

Еще в разделе: (Показать все результаты (>105) - biochem.bio.msu.ru/ )

• Binding of ouabain and marinobufagenin leads to different structural changes in
• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of

... 2000 December 15 . IC443's Neutron Star . ... Explanation: Using x-ray data from the orbiting Chandra Observatory along with radio data from the Very Large Array , a team of researchers has discovered evidence for a new example of one of the most bizarre objects known to modern astrophysics -- a neutron star . ... The core collapsed when the star, located a reassuring 5,000 light-years away in the constellation Gemini , exploded long ago. How long ago? ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 January 3 - Cas A Supernova Remnant in X Rays

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

. [ Войти ] . Главная -> Фильмы -> Control Alt Delete . Пользователи . Демо . Деньги . Фильмы . Форум . Control Alt Delete . Канада 2008 . отметить . Комедия . Драма .

Еще в разделе: (Показать все результаты (>50) - kinfo.ru/ )

• A Different Loyalty - Фильмы - Kinfo.ru
• A Different Kind of Christmas - Фильмы - Kinfo.ru
• Messages Deleted - Фильмы - Kinfo.ru

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

MGU Botanic Garden . SCHEDULE OF EXCURSIONS FOR INDIVIDUAL VISITORS . If you want to express your opinion about our excursions or suggest any proposals and make remarks, write us at otzyv_botsad@mail.ru . ... The excursion bureau of the MSU Botanical Gardens invites in May-October schoolchildren, students and anyone wishing to admire the open air collections and listen to the captivating stories about plants. ... Plant taxonomy (for schoolchildren and university students) . ...

Еще в разделе: (Показать все результаты (>10) - botsad.msu.ru/ )

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>23) - foroff.phys.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>16) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>75) - geophys.geol.msu.ru/ )

• TES. Field example.
• Anis. Page2
• TES tecnology. MSU.

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• User's guide
• Alignment example

INTERNET TECHNOLOGIES AND NEW CONCEPTION OF WDCs SYSTEM P.Yu.Pletchov, (Computer Center, RAS, Moscow, Russia, E-mail: lym@ccas.ru) Yu.S.Tyupkin (National Geophysical Committee of Russia Federation and Geophysical Center of RAS, Moscow, Russia, E-mail: tyupkin@wdcb.rssi.ru) In this technical report we wish to discuss the problem of setting up the distributed information system as a part of new conception of World Data Centers system. ... 4) Editing descriptions of an information resource by user. ...

Еще в разделе: (Показать все результаты (>320) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/ZaitsevV.htm
• http://geo.web.ru/conf/alkaline/2009/Krasnova.htm
• Все о геологии :: ChemEl 1.0