... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Beware of The Small Writing In A Loan Con . ... If you are an eligible borrower, you are able to require a CDC/504 loan by a Certified Development Company (CDC) that works well closely with SBA and private sector lenders to make sure private financing to small businesses. financing options Old people should focus on their in everyday life, as there could possibly be some accidents. ...

Еще в разделе: (Показать все результаты (>2842) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: ten example, Dragon of current
• Экологический Форум - Фундаментальная Экология: example, with Rolex, showing
• Экологический Форум - Фундаментальная Экология: on the will example, refine

О лаборатории . ... Лаборатория теоретической биофизики . ... Here we provide some instructions that will allow you to make your own visualization using powerful abilities of PyMol. Below you can find step-by-step instruction of how to visualize partial charges or other atomic information. ... Partial charge? All charges will appear near all atoms! ... Нет комментариев " Visualize partial charges in PyMol " . ... Visualize partial charges in PyMol . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>33) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>163) - sp.cs.msu.ru/ )

• DVM отладчик. Детальный дизайн. Часть 4

fitshdr - FITS-file headers manipulation tool fitshdr [options] [FITSfile_name] . ... fitshdr [options] --edit FITSfile_name . ... If You want to modify headers of FITSFILE using new FITS-header lines from HEADER file (or from stdin), You have to use this option (You can skip this option, if -H or --header option is used). ... Empty header lines are not displayed (in 'dump' mode only). --line-offsets . ... In 'dump' mode: file offset will be displayed for each header line. --no-line-offsets . ...

Еще в разделе: (Показать все результаты (>164) - lnfm1.sai.msu.ru/ )

• SOFTWARE HSFA 2

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

Copyright 1998-2007 The Jmol Development Team This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. ...

Еще в разделе: (Показать все результаты (>52) - monkey.belozersky.msu.ru/ )

• http://monkey.belozersky.msu.su/npidb/jmol/README.txt
• SDP home page
• Example of supporting positions

Introduction Globus ToolkitTM Developer Tutorial The Globus ProjectTM Argonne National Laboratory USC Information Sciences Institute http://www.globus.org/ Copyright (c) 2002 University of Chicago and The University of Southern California. ... Detailed understanding of component functionality ­ Ability to combine components in useful ways l Provide in-depth discussions of the Globus Toolkit. ... March 25, 2002 Globus ToolkitTM Developer Tutorial: Introduction 7 ...

Еще в разделе: (Показать все результаты (>61) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf
• NFS disk performance (write)

... X-COM: Distributed Computing Software . ... The idea of distributed computing, or metacomputing, is to combine available computational resources for different applications processing. ... For these applications we simultaneously used high-performance computational resources of Moscow State University and Russian Academy of Sciences, computing centers of Saint Petersburg, Novosibirsk, Chelyabinsk, Ufa, Tomsk, etc. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• APPLICATIONS: Algorithm and Software Development | Moscow University
• Distributed Modular Monitoring System: a New Approach to Supercomputer

... As an example of such graphic software environments it is possible to name software «Alice» (http://www.alice.org/), which created by «Stage3 Research Group» (Carnegie Mellon University) and allows designing the virtual 3-D worlds, interactive games, animated stories without special programmer abilities. ... In «Alice» it is possible to create various 3Dprojecs, with ready or imported, for example from «3D Studio», models, using animation, sound-effects and object's transformation. ...

Еще в разделе: (Показать все результаты (>115) - www.mce.biophys.msu.ru/ )

• Books : Научная речь на английском языке. Новый словарь-справочник активного
• Software for testing in mathematics

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... GetWebResourceUrl(Page owner, Type type, String resourceName, Boolean htmlEncoded) +82 System.Web.UI.ClientScriptManager.RenderWebFormsScript( HtmlTextWriter writer ) +58 System.Web.UI.Page.RenderWebFormsScript( HtmlTextWriter writer ) +26 System.Web.UI.Page.BeginFormRender( HtmlTextWriter writer , String formUniqueID) +387 System.Web.UI.HtmlControls.HtmlForm.RenderChildren( HtmlTextWriter ...

Еще в разделе: (Показать все результаты (>276) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: 100 лучших компьютерных продуктов 2005 года

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Полная версия этой страницы: Write in English . Студенческий форум Физфака МГУ > Общий > Все обо всем > Юмор, развлечения, игрушки.. ... I think it would be funny to write only in English. ... Iskander . ... The topic "English at our faculty. ... Цитата(Owen @ 25 октября 2004г. - 16:34) . ... Let's write in correct english as we try in russian =) . ... 21.1.2005, 0:23 . ... I'm just wondering, is there anybody to speak Polish with? ... Цитата(Цитата Iskander @ 21 января 2005г. - 0:32) . ...

Еще в разделе: (Показать все результаты (>735) - wasp.phys.msu.ru/ )

• Write in English - Студенческий форум Физфака МГУ
• Студенческий форум Физфака МГУ > Работа в Samsung Electronics для математиков и
• Студенческий форум Физфака МГУ > Software Developer

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>23) - tukachev.flogiston.ru/ )

• Category: Новости

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>116) - www.psy.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

57. http://www.eng.math.msu.su/download/Academic_English_4.pdf

58. http://temporology.bio.msu.ru/EREPORTS/shulman-is_it_possible_to_travel_in_time_eng.pdf

59. Alignment example

60. http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/245.pdf