MAKING THE PROFILES . First of all you are expected to load a FITS file ("FILE"-"LOAD"). ... By pressing the middle button you copy the profile from the first profile window to the second one. ... An example: first integral can correspond to the profile of active region and second integral can correspond to the profile of quiet chromospheric region. ... The second profile (which is subtracted from the first one) you extract after clicking on "SUBTRACT"-"MARK QUIET PROFILE" and marking the region. ...

Еще в разделе: (Показать все результаты (>348) - lnfm1.sai.msu.ru/ )

• Data bases of Natural Satellites. Documentation. Manual
• Manpage of FITSHDR

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

QUANTUM STOCHASTIC PROCESSES This course is for 4-5th year and graduate students. ... It is dedicated to systematic account of Quantum Stochastic Processes right in the form they are actually used in theoretical calculations of Quantum Open Systems. ... LECTURE 2. ... Open systems and quantum stochastic processes. Mathematical definition of an open system and quantum stochastic process. ... Markovian quantum stochastic processes. Formal definition of quantum markovian stochastic process. ...

Еще в разделе: (Показать все результаты (>74) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/JCTE-2002-en.pdf
• http://qilab.phys.msu.ru/papers/Laser-Phys-Lett-2004.pdf
• http://qilab.phys.msu.ru/papers/SPIE-5128-37-46(2003).pdf

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

• Specification

V.A. Morozov . Regularization Methods for Ill-Posed Problems . ... This monograph presents the theory and methods of approximate solutions of basic classes of ill-posed problems. It develops an abstract approach that is characterized by the following: widespread use of methods of functional analysis; concentration on general necessory and sufficient conditions of solvability and unique solvability of corresponding problems. The basic methods discussed is the methods of psendosolutions. ...

Еще в разделе: (Показать все результаты (>90) - srcc.msu.ru/ )

The Chair of Mathematical Theory of Intelligent Systems and . ... Research . ... Computer Solver . ... Computer Teacher . development of computer teaching systems . ... Demos . ... Demo program (to setup it on your computer you should copy the setup file to some directory on your hard disk and then unzip it). Presentation (in Microsoft Power Point format) . Demo program (to setup it on your computer you should copy the setup file to some directory on your hard disk and then run it). ...

Еще в разделе: (Показать все результаты (>64) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Intelligent Systems :: Research :: :: Articles

... The main goal of the interdisciplinary MCE conferences is organization of the productive interaction between scientists and higher education staff, preservation of traditions of Russian science and education, training of scientific and pedagogical staff in the field of mathematical modeling and information technologies and attraction of young people into science and education. [ read more.. ... Doctor of Biological Sciences, Professor, Moscow State University and Institute of Gene Biology. ...

Еще в разделе: (Показать все результаты (>216) - www.mce.biophys.msu.ru/ )

... Data . ... Solar energetic particles . ... Nucleon . ... Particle spectra at LEO . ... Overview ] [ Documentation ] [ SEP Events ] [ SEP Model ] . ... 1.2 High-energy heavy ions (Z = 6, 7, 8, 10, 12, 14, 16, and 26) by ACE spacecraft (SIS instrument) data are selected from: . ... The SEP events were selected by GOES-8 4th channel (15-40 MeV) data (see Fig.1). ... E тАУ ionтАЩs kinetic energy in MeV/nucl; Moc2 =938 MeV тАУ nucleon rest energy; †Я=v/c тАУ particleтАЩs relative velocity. ...

Еще в разделе: (Показать все результаты (>18) - smdc.sinp.msu.ru/ )

• APEV service - Space monitoring data center
• ShielDose2 model - Space monitoring data center

Zebra : web-server for bioinformatic analysis of large protein superfamilies to identify variable amino acid residues responsible for functional diversity Dmitry Suplatov, Evgeny Kirilin, Vakil Takhaveev, Vytas Svedas Lomonosov Moscow State University, Belozersky Institute ... Zebra has been applied to study how lipase and amidase catalytic activities are implemented into the alpha-beta hydrolase fold. ... Greek letters represent different functional classes within the family. ...

Еще в разделе: (Показать все результаты (>225) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/23.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/16.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/49.pdf

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>85) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - Cube files
• Firefly DOCUMENTATION - command line arguments
• Firefly for Mac OS X: main page

... J.K. Krylov . In the monography by R. Koehler [1] there was described a very interesting effect of the words' average length oscillation as a function of their frequency of use (according to the data from a representative frequency dictionary). ... In this context, further the Koehler's effect will be definied as polymodal character of the dependence of the conditioned average in cases of two-dimencional distributions of any linguistic nature. ...

Еще в разделе: (Показать все результаты (>53) - old.philol.msu.ru/ )

• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

FEATURES OF THE HYDROGEN DISTRIBUTION AROUND LUNAR CRATERS PROCLUS AND KEPLER. ... In result of analysis of the data Lawrence and Feldman constructed the hydrogen distribution on the lunar surface [1]. ... However, the authors shown, that EN flux data features may be explained by other element abundance in the lunar soils, namely: Si, Ca, Gadolinium (Gd), Samarium (Sm) and Fe. ... Using of the Feldman's interpretation of the Lunar Prospector data [8], we constructed hydrogen distribution map (Fig.1). ...

Еще в разделе: (Показать все результаты (>88) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Bus/Publications/LPSC2001a/LPSC2001a.pdf
• http://selena.sai.msu.ru/Shev/Publications/ms38/ms083.pdf
• http://selena.sai.msu.ru/Chik/Publications/ms42/m42_12.pdf

... ENTANGLED STATES IN OPTICS Measurement of Qutrits A. V. Burlakov, L. A. Krivitskioe, S. P. Kulik, G. A. Maslennikov, and M. V. Chekhova Faculty of Physics, Moscow State University, Moscow, 119899 Russia e-mail: postmast@qopt.phys.msu.su Received November 25, 2002 Abstract--A method of optical realization of a protocol of restoration of the density matrix of an unknown state of a three-level system that represents an arbitrary polarization state of a single-mode biphoton field is proposed. ...

Еще в разделе: (Показать все результаты (>95) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2007-jetp(e)-104-736.pdf
• http://qi.phys.msu.su/papers/2007-os(e)-103-107.pdf
• http://qi.phys.msu.su/papers/2007-jetp(e)-104-30.pdf

... Mosekilde E. Department of Physics, Technical University of Denmark, Kgs. ... The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. ... Regulation of pressures and flows in the individual nephron involves the interaction between the tubuloglomerular feedback mechanism (TGF) and the oscillatory response of the activated afferent arteriole. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>91) - www.msm.biophys.msu.ru/ )

• Approved Presentations

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... In this case both the medium and the electric field depend on two space coordinates only. ... The classical modeling presentation is in apparent resistivity which reflects an electric field distribution on the earth's surface. ... An expression can be derived for the potential value in point M ([pic]): [pic], (4) where [pic] is the potential of the primary electric field, [pic] is the potential of the secondary electric field, defined by the surface charge distribution. ... pic] |[pic] | ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... For example, one can consider Gauge theories Extra conditions · there are no sources which are external to the system described by the presented action · solutions to equations of motion are periodic in time with a period T up to a coordinate shift and a spatial rotation, i.e. for all fields on the solution the relation must hold for any t One can always pass to a suitable coordinate system in which One can use the effective ... Math. ... B 68 (1977) 466; S.R. Coleman, Commun. ...

Еще в разделе: (Показать все результаты (>133) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2011/tsirova_qfthep.pdf
• http://qfthep.sinp.msu.ru/talks/Slavnov.pdf
• http://qfthep.sinp.msu.ru/talks/rep_M_QFTHEP.pdf

Psychology in Russia: State of the Art · 2009 Relativist Psychology: a New Concept of Psychological Measurement 263 Relativist Psychology: a New coNcePt of Psychologic al MeasuReMeNt Anatoly P. Suprun Institute of systems analysis, Russian Academy of Sciences Moscow The article demonstrates the inadequacy in the traditional approach of psychology to the description of products of mental representation of perception. ... Here each vector coordinate corresponds to the intensity of a specific property. ...

Еще в разделе: (Показать все результаты (>153) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2012/astaeva.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/nikolaeva.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/sokolova.pdf

Astronomy Picture of the Day . September s Harvest Moon . ... 16.09.2011 . ... Credit Copyright: Stefano De Rosa Explanation: A Full Moon rising can be a dramatic celestial sight , and Full Moons can have many names. For example, Monday's Full Moon was the one nearest this year's autumnal equinox for the northern hemisphere, traditionally called the Harvest Moon. ... September 2011 . ... Publications with keywords: equinox - full moon . Publications with words: equinox - full moon . ...

Еще в разделе: (Показать все результаты (>5236) - www.astronet.ru/ )

• Saguaro Moon
• Journal "Peremennye Zvezdy"
• The ISS and a Colorful Moon

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>102) - hbar.phys.msu.ru/ )

• njudge.htm