... Academic . ... Academic Departments . ... Partners . ... All partners . ... 23.12.2015 On December 22, 2016 the prime-minister of Russia Dmitry Medvedev ordered to award the prizes for the honors in the field of media. The prize for the personal contribution to the media development is awarded to the President of the Faculty, Professor Yassen Zassoursky. We a glad to congratulate Professor Zassoursky and wish him new and bright academic achievements! ...

Еще в разделе: (Показать все результаты (>59) - www.journ.msu.ru/ )

• International Conference of Russian Society of American Culture Studies ::

. Name . Last modified . Size . Description . Parent Directory . - . Apache/2.2.16 (Debian) Server at textbook.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>7) - textbook.sinp.msu.ru/ )

... name="WebHome" This is a subscription service to be automatically notified by e-mail when topics change in this About web. ... Users subscribe to email notifications using their WikiName or an alternative email address, and can specify the webs/topics they wish to track, Whole groups of users can also be subscribed for notification. ... Examples: Subscribe Daisy to all changes to topics in this web. * daisy.cutter@flowers.com Subscribe Daisy to all changes to topics that start with Web . ...

Еще в разделе: (Показать все результаты (>37217) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (3 vs. 4) - TWiki
• %TOPICTITLE% (1 vs. 3) - TWiki

Международный учебно-научный лазерный центр МГУ им. М.В. Ломоносова . Главная . ... О МЛЦ МГУ . Наука . ... Публикации . ... 15.12.2015 . ... Заявки до 25 октября 2015г. Семинар МЛЦ и кафедры . ... Главная Публикации . ... Год: 1998 . ... 2008 МЛЦ МГУ . ...

Еще в разделе: (Показать все результаты (>101) - ilc.phys.msu.ru/ )

... A This result can be applied to a wide variety of data sets, including electricity bills1, street addresses, lengths of rivers, physical and mathematical constants, and processes described by power laws. ... Based on the plausible4 assumption that people who make up figures tend to distribute5 their digits fairly uniformly, a simple comparison of first-digit frequency distribution from the data with the expected distribution according to Benford's law had to show up any anomalous results. ...

Еще в разделе: (Показать все результаты (>17) - www.eng.math.msu.su/ )

... The last meeting place to get orders was a trap!! ... Additional Credits to : Id Software for DOOM. ... Play Information * Game : DOOM ][ (v1.9 Tested) Level # s : MAP01 Single Player : Yes Cooperative 2-4 Player : No Deathmatch 2-4 Player : Starts are there. ... New Sounds : Yes New Graphics : Yes New Music : Nope Demos Replaced : None * Construction * Base : Created from scratch. ... Copyright / Permissions * Players MAY NOT use these wads as a base to build additional levels. ...

Еще в разделе: (Показать все результаты (>5347) - crydee.sai.msu.ru/ )

• Lists in HTML documents
• Index of /public/lyrics/cs-uwp/t/the.new.order
• Index of /public/lyrics/cs-uwp/n/new.order

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>193) - www.geogr.msu.ru/ )

• Получение снимков Terra по Интернет

... June, 2005 . ... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! Order of Legion of Honour . Victor Sadovnichy,the rector of the Moscow М.В. Lomonosov State University was awarded with the Order of Legion of Honour. (more.. ... Discover Russia with us! www.rlcentre.com . ... The first conference on preserving Russian language and Russian culture is to open in Gatesburg, Maryland. (more.. ...

Еще в разделе: (Показать все результаты (>16) - www.rlcentre.com/ )

... The purpose of individualized education is to ensure that every student gains access to knowledge, skills and information that will prepare him/her to contribute to variety of communities and workplaces. ... In the USA there are some Schools of Individualized Study. ... That?s why we can describe the individualized study as the basis for introduction to the students? opportunities for self-discovery, diversity and flexibity of the curriculum, creativity and academic exellence. ...

Еще в разделе: (Показать все результаты (>151) - www.prof.msu.ru/ )

• RUSSIA UNDER PUTIN
• Global Terrorism, Domestic Order and the United States

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>141) - higeom.math.msu.su/ )

• INVITED ADDRESSES:

This is a subscription service to be automatically notified by e-mail when topics change in this _default web. ... Users subscribe to email notifications using their WikiName or an alternative email address, and can specify the webs/topics they wish to track. ... IT:admins' : Web* . A user may be listed many times in the WebNotify topic. ... A subscriber identified by an email address alone will only be sent change notifications if the topic they are subscribed to is readable by guest users. ...

Еще в разделе: (Показать все результаты (>5041) - wiki.cmc.msu.ru/ )

• WebNotify < PracticumV < Foswiki
• WebNotify < Practicum < Foswiki
• WebNotify < Lectures < Foswiki

Friday, December 7th, 2012 . ... No Comments ? Monday, December 3rd, 2012 . Добавлена страничка со списком публикаций сотрудников лаборатории за 2012 год. ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for December, 2012. ... Публикации за 2010 . Публикации за 2011 . Публикации за 2012 . ... January 2013 . December 2012 . ... January 2012 . ... January 2011 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>39) - geo.sai.msu.ru/ )

• December 2010 Лаборатория лазерной интерферометрии

... Moscow State University . Institute of Mechanics of MSU . Dept. of Mechanics and Mathematics of MSU . ... Russian Foundation of Basic Research . ... Since 1976 through 2008 the Conference was organized by the Institute of Mechanics of Moscow State University (see http://hit2003.narod.ru/ ). ... MS Word format manuscripts should be sent to gertsens@imec.msu.ru before 15 January 2010. ... Presentation title. ... Institute of Mechanics , Moscow State University . ... 119899, Moscow , Russia . ...

Еще в разделе: (Показать все результаты (>17) - hit-conf.imec.msu.ru/ )

Baryogenesis in non-minimal split Sup ersymmetry mo del Kirpichnikov D.V. Institute for Nuclear Research RAS kirp@ms2.inr.ac.ru June 26 2015 Setup of non-minimal split SUSY model (split NMSSM) CMB (PDG 2013): 6.1 в 10- 10 < nB < 6.9 в 10-10 . ... Kirpichnikov D.V. (INR RAS) Split NMSSM 12 / 15 1e-27 1e-27 |de/e| 1e-28 |de/e| 1e-28 1e-29 110 115 120 125 130 135 m+, GeV 140 145 150 1e-29 110 115 120 125 m+, GeV 130 135 The EDM of electron versus experimental bound is |de /e | ...

Еще в разделе: (Показать все результаты (>163) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/Bunichev_singletop_tWb_LHC.pdf
• Travel Information

Mitrokhin S. I. Spectral Properties of a Fourth-Order Differential Operator with Integrable Coefficients. Proceedings of the Steklov Institute of Mathematics, 2010, Vol.270, pp. 184-193. ... 2010. Original Russian Text: S. I. Mitrokhin, 2010, published in Trudy Mathematcheskogo Instituta imeni V. A. Steklova, 2010, Vol. 270, pp. 188-197. ...

Еще в разделе: (Показать все результаты (>85) - srcc.msu.ru/ )

• Mitrokhin S. I. About the Differential Operator of the Eight-Order with
• Natalia Pertsova. Towards developing a model of Russian derivation // 3rd
• История НИВЦ

Gus Koehler . Useful Hints for Reordering the Universe . Gus Koehler, Time Structures . Alfonso the Wise, King of Castile (1221-1284) said: “Had I been present at the Creation, I would have given some useful hints for the better ordering of the universe.” What would King Alfonso the Wise have to know about space/time ordering to make useful hints to God? ... Can the King use time to order space? ... What useful hints can the King of Castile provide to God? ... Time, Order and Chaos . ...

Еще в разделе: (Показать все результаты (>415) - chronos.msu.ru/ )

• Кохлер Г. (Koehler G.)
• Russian Interdisciplinary Temporology Seminar
• THE SYSTEM OF TIME AND ITS OWN WORLDS

... 2013/04/16 - 11:59am . ... After the education at High School of Management and Innovation graduates receive the state approved diploma of Lomonosov Moscow State University for a specialized educational programme "Strategic Management and Innovation" and become "Masters of Management". ... Admission procedure in 2013 in direction of "Management" for the programme "Strategic Management and Innovation" provides for contracts with 50 persons . ... 2006-2016 MSU Higher School of Management and...

Еще в разделе: (Показать все результаты (>3) - hsmi.msu.ru/ )

... Science . ... lrm@cs.msu.su . ... The Laboratory of Difference Methods was founded by A.A.Samarsky, Academician of RAS, in the middle of the 60s. For more than 50 years the Laboratory?s theoretical research has been focused on numerical methods for problems described by systems of partial differential equations. ... N.V.Ardelyan, V.L.Bychkov, I.V.Kochetov and K.V.Kosmachevskii, Non-self-maintained discharge plasma in propane-air mixture // IEEE Trans. on Plasma Science, vol. 39. no. 12, part 1, pp. ...

Еще в разделе: (Показать все результаты (>260) - en.cs.msu.ru/ )

• Laboratory of Programming Technologies
• Department of Information Security
• Laboratory of Difference Methods

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Generic Regularization of Boosting-Based Optimization for the Discovery of Regime-Independent Trading Strategies from High-Noise Time Series . ...

Еще в разделе: (Показать все результаты (>210) - graphics.cs.msu.ru/ )

• Generic regularization of boosting-based algorithms for the discovery of
• Discovery of multi-component portfolio strategies with continuous tuning to the
• Detection of multiple object instances using Hough transform | Graphics and

AC201621_1 [925 - 1275] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. MLSSITTRKKPQSIANQSRCSWVTNPANCPHSQAASIHTTKVITAKTIGGSKNNAHITIG IKIKAVIKRYFSKRVSPKMLLHRYRQVRVPQNDAHVGQTLPMPFQKQVHQNQARVYL >AC201621_2 [3300 - 3587] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. ...

Еще в разделе: (Показать все результаты (>1872) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~tregubova/projects/Term_3/ac201621.orf
• http://kodomo.cmm.msu.ru/~ksenechka91/names.txt
• TracTicketsCustomFields тАУ Tanchiki