... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Special Sessions . ... Optimal control and differential games in economics . ... Game-theoretical control problems and Hamilton-Jacobi equations . ...

Еще в разделе: (Показать все результаты (>37) - pont2008.cmc.msu.ru/ )

• Differential Equations. Poster session Международная конференция
• Optimal Control and Differential Games. Poster session Международная
• News International Conference Differential Equations and Topology dedicated to

.

Еще в разделе: (Показать все результаты (>187) - nuclphys.sinp.msu.ru/ )

• Летняя школа в ЦЕРНе (2007 г.)
• Dark Matter Experimental Researches at LNGS
• Новая страница 1

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>79) - qilab.phys.msu.ru/ )

... He distributes these gifts in sacks (each sack can contain from 1 to n items) and puts the sacks with gifts around the Christmas tree (only the content of the sacks and their ordering on the circle around the tree are important). ... A river falling into a sea forms a delta which is a system of branches consisting of channels without inner intersections. (a) Suppose that in a given delta there are exactly n different (i.e. differing by at least one channel) routes down the stream. ...

Еще в разделе: (Показать все результаты (>2) - www.universe.msu.ru/ )

Prof. Stephen Duncombe New York University Mediated Imagination in a Digital Age Imagination is an essential human practice. ... Because we are in the middle of a media sea-change, moving from page to screen and broadcast to web, this seminar will pay special attention to how imagination is constituted and communities are imagined within and through our present digital age. ... How can imagination prefigure a new world instead of bolstering the old? ... RanciХre, The Politics of Aesthetics . ...

Еще в разделе: (Показать все результаты (>308) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/SpeechGroup/publications/krivnova-2005-2006/krivnova_specom-2006_angl.doc
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/romanova.pdf

.

Еще в разделе: (Показать все результаты (>45) - new.math.msu.su/ )

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>220) - herba.msu.ru/ )

• ALGAE AND THEIR CHANGES OVER TIME
• Behaviour of white water-lily flowers in different photoperiods
• Insect catching and carnivorous plants

... Natalia Kireeva graduated from the department of biochemistry and worked in different laboratories in Moscow and the USA. ... Maria Sudnitsyna graduated from Moscow State University in 2004, and during the next two years, she investigated the mechanisms of the function of mitochondrial Complex I. Then, she continued her work in a biotechnological firm, and in 2008, she returned to Moscow State University and started her work at the Department of Biochemistry in the group of Prof. N.B. Gusev. ...

Еще в разделе: (Показать все результаты (>92) - biochem.bio.msu.ru/ )

• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of
• Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling

. home page . lab members . about us . foto&video . articles . links . The page is under construction

Еще в разделе: (Показать все результаты (>45) - cellmotility.genebee.msu.ru/ )

• Alieva Irina
• publications

... Полная версия этой страницы: After Session . Студенческий форум Физфака МГУ > Физфак и учеба > Форумы групп > 10 группа 2005 года рождения . ... Всех, кто сдал сессию на положительные оценки, поздравляю и желаю круто отдохнуть. Всем, кто не сдал, крепитесь, готовтесь и все будет ОК. ... 22.1.2006, 1:31 . ... Bender . ... Поздравляю всех кто сдал . ... drdieselal . ... 2 Bender где ж тебя так угораздило? ... Хорошо что еще 2 экзамена успел сдать, а то бы вообще лажа полная бы была. ...

Еще в разделе: (Показать все результаты (>420) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > 11.08/ 18.08 / 25.08 - OPEN AIR SESSIONS: DNB/
• After Session - Студенческий форум Физфака МГУ
• Студенческий форум Физфака МГУ > Работа в Samsung Electronics для математиков и

Mechmath admission for internetional students . Specialist degree . ... Specialist variants . Master degree . ... Master variants . ... Scientific Research Training . ... We?ll tell you what you need to know about the Festival of Science. ... What is the Festival of Science, and why is it so attractive to all who have participated in it?both children and adults?that they look forward eagerly to each new Festival? ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>17) - pk.math.msu.ru/ )

• Mechmath admission for internetional students

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>11) - iconolat13.phys.msu.ru/ )

. General Information . Media Files . Participants . Timetable . Local Information . Photos . October 9, 10:00 10:40 . Nicolai Shatsky (SAI) . PDF [5.6б MB] October 9, 10:40 12:00 . October 9, 12:00 12:30 . Marc Sarazin (ESO) . PDF [326.1б KB] .

Еще в разделе: (Показать все результаты (>30) - site2010.sai.msu.ru/ )

• Timetable

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>170) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Лаборатория регуляции белкового синтеза

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... This server is using a newer protocol (47) then your clien . ... Re: This server is using a newer protocol (47) then your clien [ re: Sm1rk ] . ...

Еще в разделе: (Показать все результаты (>2772) - www.snto-msu.net/ )

• Продам мультисервисный маршрутизатор Cisco 2611 - Public forum of MSU united
• CDemu 1.1.0 Release - Public forum of MSU united student networks

... Foswiki::Request::Cache - Class that implements a disk cache of Foswiki::Request objects. ... public package Foswiki::Request is a CGI . ... ObjectMethod action([$action]) $action . ... ObjectMethod queryParam( [-name $name, -value => $value | ObjectMethod bodyParam( [-name $name, -value => $value | ... Keys are uploaded file names, as sent by browser, and values are Foswiki::Request::Upload objects. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>1819) - wiki.cs.msu.ru/ )

• AppendixEncodeURLsWithUTF8 < System < Foswiki
• InstallationGuidePart2 < System < Foswiki

... Астронет | ... планета Астронет | ... N. Bochkarev . ... The new 2-M RCC telescope in the northern caucasus for modern astronomical research . ... Basic magnetic field configurations for filament channels and filaments . ... An excitement of the gravitational and acoustic waves in the solar atmosphere caused by the inhomogeneous flow . ... Solar cycle variation of the solar corona shape: A new outlook . ... The collision of the comet Shoemaker - Levy 9 with Jupiter . ...

Еще в разделе: (Показать все результаты (>7841) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• APOD: 2006 September 29- NGC 5905 and 5908
• An Orion of a Different Color

. Hobby >> Games (Archive) . Страницы: 1 | (16) . Mr_Hurma_xD : Re: The Elder Scrolls Online: stress test session [re:SpellBuilder] 27.02.2014 08:57 | Reply | Edit | . 0 . действуй . Top .

Еще в разделе: (Показать все результаты (>4185) - www.fds-net.ru/ )

• Продам мультисервисный маршрутизатор Cisco 2611 - Public forum of MSU united

... Higgs boson results from ATLAS . Slides . ... Higgs boson discovery and recent results (CMS) . ... Resent results of the CMS experiment . ... Contribution . ... Electroweak top quark production . ... The ATLAS hadronic calorimeter at the LHC and the phase II upgrade program . ... Double Higgs production at LHC in the Standard Model extended with an isosinglet . ... Top physics results with ATLAS . ... Inclusive Higgs boson production at LHC within the kT-factorization approach . ...

Еще в разделе: (Показать все результаты (>207) - qfthep.sinp.msu.ru/ )

• QFTHEP'2015 Plenary Talks
• June 30, 2015
• June 25, 2013

Russian Interdisciplinary . Temporology Seminar: . ... Journals about time . ... September 21, 258 session. ... The discovery of Kopernik had put the beginning to understanding the corporal nature of celestial lights and penetrating into the laws governing the World of material bodies. ... CHANGE OF VIEWPOINTS ON THE NATURE OF TIME ON TIME OF SCIENTIFIC PARADIGM CHANGE". ... The problem of connection of an entropy? growth with quantum model of physical world particles interactions is basic. ...

Еще в разделе: (Показать все результаты (>456) - chronos.msu.ru/ )

• Simakov K
• Rational Fertilization of Fish Ponds Populated by Different Species
• Lev Kupershmidt