... Development of a candidate secondary reference procedure (immunoassay based measurement procedure of higher metrological order) for cardiac troponin I: I. Antibody characterization and preliminary validation. ... In this study, the first steps in the development of a secondary reference measurement procedure (RMP) 'higher metrological order measurement procedure' to support the cardiac troponin I (cTnI) standardization initiative is described. ...

Еще в разделе: (Показать все результаты (>212) - biochem.bio.msu.ru/ )

Database: . ... Affymetrix official site . ... Clone/Gene ID converter . ... Probe set search: . Affymetrix probe set identifier example: "238900_at" . ... Search . Text search: . Gene official symbol (*-wildcard) example: "c1orf*" . Word or phrase in gene official name example: "receptor" . ... Gene search: . ENSEMBL gene identifier example: "ENSG00000026508" . NCBI Entrez Gene identifier example: 7503 . HUGO gene identifier example: 1681 . ...

Еще в разделе: (Показать все результаты (>8) - mouse.belozersky.msu.ru/ )

... Query= sp|P0AAI3|FTSH_ECOLI Cell division protease ftsH OS=Escherichia coli (strain K12) GN=hflB PE=1 SV=1 (644 letters) Database: pm 204 sequences; 2,269,587 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006080 Pasteurella multocida subsp. multocida str. Pm70 sectio.. ... Pm70 sectio... 48 2e-06 AE006234 Pasteurella multocida subsp. multocida str. ... Pm70 section 47 of 204 of the complete genome. ...

Еще в разделе: (Показать все результаты (>2015) - kodomo.cmm.msu.ru/ )

• page of Dovgan Kirill

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>134) - srcc.msu.ru/ )

• University Information System RUSSIA
• Научно-исследовательский вычислительный центр МГУ

Home . ... Activities . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Image enhancement . ... Rank image filtering . Image analysis . ... Ringing effect . ... Database . ... Medical imaging . ... Multiresolution analysis and processing . ... The final version of the developed ringing database is available here: . ... The ringing extension of TID 2013 database: . ...

Еще в разделе: (Показать все результаты (>835) - imaging.cmc.msu.ru/ )

• View publication | Laboratory of Mathematical Methods of Image Processing
• Ringing effect modeling | Laboratory of Mathematical Methods of Image...
• Ringing analysis | Laboratory of Mathematical Methods of Image Processing

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

... Science . ... lrm@cs.msu.su . ... The Laboratory of Difference Methods was founded by A.A.Samarsky, Academician of RAS, in the middle of the 60s. For more than 50 years the Laboratory?s theoretical research has been focused on numerical methods for problems described by systems of partial differential equations. ... N.V.Ardelyan, V.L.Bychkov, I.V.Kochetov and K.V.Kosmachevskii, Non-self-maintained discharge plasma in propane-air mixture // IEEE Trans. on Plasma Science, vol. 39. no. 12, part 1, pp. ...

Еще в разделе: (Показать все результаты (>123) - en.cs.msu.ru/ )

• Laboratory of Difference Methods

... Copyrightї1997 Bob Yen (byen@ix.netcom.com) (http://www.comet-track.com/hb/hb.html) . ... Information on Comet Hale-Bopp for the Non-Astronomer Hale-Bopp rotates about twice a day (3/14/97) . ... The Comet Observation Home Page was been selected to receive the Griffith Observatory Star Award for the week of February 2 - 8, 1997 for excellence in promoting astronomy to the public through the World Wide Web. ... Typically, about 1,000 individual users/computers access this page every day. ...

Еще в разделе: (Показать все результаты (>25) - www.issp.ac.ru/ )

• The International Olympiad of Euro-Asian Astronomical Society
• II International Astronomy Olympiad, Problems to solve

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>7) - npidb.belozersky.msu.ru/ )

• NPIDB: About Us

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog King 19
• SAI OCL Catalog King 13
• SAI OCL Catalog Koposov 12

... 13, Moscow 119992, Russian Federation, e-mail: busarev@sai.msu.ru; 2 Research Institute Crimean Astrophysical Observatory, p/o Nauchnyi, Crimea 334413, Ukraine, e-mail: prok@crao.crimea.ua Summary: We propose a combined method of astronomical investigations of small or distant planets incorporating registration of a set of integral spectra of an object and their frequency analysis. ... An application of the method is shown on example of asteroid 21 Lutetia. ... 6] Busarev V. V. (2002), Solar Sys. ...

Еще в разделе: (Показать все результаты (>153) - selena.sai.msu.ru/ )

• Zhanna F. Rodionova
• List of publications
• Vladislav V. Shevchenko

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

... RAMPA - CASE for portable parallel programs development?. ... N.A. Konovalov, V.A. Krukov, S.N. Mihailov and A.A. Pogrebtsov. Fortran DVM - a Language for Portable Parallel Program Development? ... Fortran DVM - A Language for the Development of Portable Parallel Programs. ... Development of Portable Program System for Modeling Neutron-Physical Processes in Nuclear Reactor on Parallel Computers. ... C-DVM-A Language for the Development of Portable Parallel Programs. ...

Еще в разделе: (Показать все результаты (>118) - sp.cs.msu.ru/ )

• Logic and Databases

... Time calculated from Fermi GBM Trigger Time = 14:12:08.67 ( Connaughton, GCN 9230 ). 1% coincident with our start zero image time. 3x3 degrees around Swift XRT position . ... SUBJECT: GRB 090424 : MASTER-Net prompt optical limit DATE: 09/04/25 20:29:42 GMT FROM: Vladimir Lipunov at Moscow State U/Krylov Obs E. Gorbovskoy, V. Lipunov, V.Kornilov, A.Belinski ... Our observations results: ---------------------------------------------------------------------- Fermi GRB Trigg.* ...

Еще в разделе: (Показать все результаты (>257) - observ.pereplet.ru/ )

• Observatory
• MASTER GLOBAL ROBOTIC TELESCOPES NET

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>24) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/zzx/11_2_en.doc

Help www.sciencedirect.com www.sciencedirect.com R www.sciencedirect.com , ScienceDirect. , (licensed user). ... R PAGE 1 OF 9 www.sciencedirect.com Quick Search, Journals, Books, Reference Works and Abstract Databases Quick Search ( ), Journals (), Reference Works ( ), Books ( ) Abstract Databases ( ). Quick Search ( ) - , . ... ProCite, EndNote Reference Manager). 3a 3a R PAGE 8 OF 9 www.sciencedirect.com 1 Alerts ( ) , , : I Search Alerts ( ); I Journals Issue Alerts ( ); I Citation Alerts ( ). ...

Еще в разделе: (Показать все результаты (>7) - wwwlib.phys.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>2974) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~xedin/Term2/Practice3/srs_tables.doc

A hybrid database (information system) on the molecular spectral constants" . Kochikov I.V., Kuramshina G.M., Samkov L.M., Sharapov L.A., Sharapova S.A. A database (information system) on the molecular constants of the crude oil compounds and products of oil refinement is presented. ... A hybrid-type information system includes references and information modules integrated with a numerical package allowing immediate basic processing of molecular spectral data. PostScript (in Russian) (215KB) . ...

Еще в разделе: (Показать все результаты (>241) - num-meth.srcc.msu.ru/ )

• Information for Authors
• General Information
• Publication Ethics and Publication Malpractice Statement

... Alphabetical Class List . ... OpenGL 3D Graphics Support . Netscape/Explorer Plugin Support . ... Troll Tech Contact Information . ... It is a product of Troll Tech . ... Qt Professional Edition is provided for commercial software development. It is provided with upgrades and technical support. ... Qt Free Edition is the Unix/X11 version of Qt available for development of free software only. It is provided free of charge under the Qt Free Edition License . ... Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>588) - rtm-cs.sinp.msu.ru/ )

• Obtaining Initial References
• Reference Counting
• Stringified Object References