... MBA . EXECUTIVE MBA . ... По итогам обсуждения докладов, представленных другими участниками (Prof. Helio Zylberstajn , Universidade de Sao Paulo , Brazil , Prof . Anil Verma , University of Toronto , Canada , Prof . Venkata Ratman , IMI , New Delhi , India , Prof . ... Executive MBA . ...

Еще в разделе: (Показать все результаты (>35) - www.mgubs.ru/ )

День Физика . Преподаватели физфака . ... Форум . Главная . Новости . ... Абитуриентам . ... Главная Новости Физфак . ... В расписании возможны изменения. ... Физфак . ... Новости сайта . ...

Еще в разделе: (Показать все результаты (>23) - www.dubinushka.ru/ )

• Добавлены фотографии с Посвящения'07 | Новости
• Внимание!!! 3 КУРС! Вопросы по психологии к экзамену | Новости
• Ядреный и Атомный праки | Новости

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Coordinator in Import Licensing of Special Technical Equipment (STE) . ... Acts as the consultant to business units in import and licensing area of Russian STE market. ... Acts as a specialist providing implementing of STE import, distribution and licensing processes and policies. ... Experience in coordination of IT legislation and IT Security area, STE import and licensing would be a significant advantage . ...

Еще в разделе: (Показать все результаты (>20) - www.physcareer.ru/ )

• Radio Frequency Licensing Coordinator (Graduate) / Вакансии / Physcareer.ru

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>4) - imaging.cs.msu.ru/ )

METHOD FOR FACE TRACKING IN VIDEO SEQUENCE Loshkarev I.V., Demyanenko Y.M. Southern Federal University, 8a Milchakova st., Rostov-on-Don, 344090, Russia One of the established standards for face tracking in the image is method developed by Viola and Jones [1]. ... Then the template is constructed using the contour representation of the face. With this representation, position and orientation of the face in next frames can be obtained using the generalized Hough transform [2]. ...

Еще в разделе: (Показать все результаты (>32) - www.mce.biophys.msu.ru/ )

Студенческий сайт Физфака МГУ . ... Студенческий форум Физфака МГУ Общий Все обо всем Цифровые технологии . Новый страшный вирус! ... Учеба |---- 03 группа 2005 года рождения |---- 05 группа 2005 года рождения |---- 06 группа 2005 года рождения |---- 10 группа 2005 года рождения |---- 11 группа 2005 года рождения |---- 12 группа 2005 года рождения |---- 13 группа 2005 года рождения |---- 15 группа 2005 года рождения |---- 16 группа 2005 года ...

Еще в разделе: (Показать все результаты (>534) - wasp.phys.msu.ru/ )

• Герловин И.Л. - Студенческий форум Физфака МГУ
• Релятивистский осциллятор - Студенческий форум Физфака МГУ
• Братья по разуму - Студенческий форум Физфака МГУ

This page is devoted to information on Supernova 1999gi in NGC 3184 . ... Information on the original web pages for many of these images can be found on the Supernova links web page. ... NGC 3184 is a fairly close Mag 10.3 galaxy, only about half as distant as the Virgo cluster. ... Seiichi Yoshida has a 1999gi page . Odd Trondal's 1999gi page . ... CfA image . ... 14.5 . ... Jean Marie Llapasset image . ... vsnet-alert 3805 ] SN 1999gi in NGC 3184 . vsnet-chat 2438 ] Host galaxy of SN1999gi . ...

Еще в разделе: (Показать все результаты (>20) - www.rochesterastronomy.org/ )

• Supernova 1998dh in NGC 7541

Реликтовое (фоновое) излучение Вселенной или всеобщий фон (background) по терминологии противников гипотезы Большого Взрыва - фундаментальное природное явление, естественная конкретизация эфира, эквивалент физического вакуума. Реликтовым оно называется потому, что образовалось, по гипотезе Большого Взрыва, при возникновении Вселенной. ...

Еще в разделе: (Показать все результаты (>183) - chronos.msu.ru/ )

... The main field of my investigations is stellar spectrophotometry. As a result of scientific activity of our group spectrophotometric catalog was created including energy distribution data on 900 stars in the range 3200-7600AA and 250 stars in the range 6000-10800AA (Voloshina et al., Spectrophotometry of Bright Stars, ed. I.N.Glushneva, 1982, Moscow, Nauka, in Russian). ...

Еще в разделе: (Показать все результаты (>6) - uranus.sai.msu.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>5) - npidb.belozersky.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>80) - nuclphys.sinp.msu.ru/ )

• The European X- Ray Free-Electron Laser

Acinonyx jubatus , Panthera onca , Panthera pardus , Puma concolor , Uncia uncia . Cranial morphology of five felids: Acinonyx jubatus , Panthera onca , Panthera pardus , Puma concolor , Uncia uncia . ... The purpose of the project was twofold: 1) to research species-specific characteristics that will differentiate five species of medium-sized felids based on skull morphology and 2) to develop identification aids to help wildlife law enforcement officers distinguish mid-size cat skulls. ...

Еще в разделе: (Показать все результаты (>381) - zmmu.msu.ru/ )

• Geographical pattern and historical demography of Midday gerbil Meriones
• Two sympatric phylogroups of the Asian badger Meles leucurus (Carnivora:
• A preliminary study on molecular phylogeny of giant flying squirrels, genus

# # ChangeLog for / # # Generated by Trac 0.12.5 # 04/12/16 00:00:30 Sun, 19 Dec 2010 21:36:19 GMT Alex Martynov [67:bec0ab8061dc] merge Sun, 19 Dec 2010 21:36:10 GMT Alex Martynov [66:547cc748b4be] * engine.py (modified) import snake + engine.legal_moves in engine.step() fixed Sun, 19 Dec 2010 21:33:24 GMT Danya Alexeyevsky <me.dendik@тАж> [65:e9c803523da4] * snake.py (modified) snake load methods: Python complains about mixing iterators & methods on ...

Еще в разделе: (Показать все результаты (>553) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=bb4a79cc6b6e424a24496b907ff54ff51d63e1c8&stop_rev=20%3Aeef739e055f4&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=bb4a79cc6b6e424a24496b907ff54ff51d63e1c8&stop_rev=19%3A3d1a72f49417&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/cca/log/?format=changelog&rev=bb4a79cc6b6e424a24496b907ff54ff51d63e1c8&limit=100&mode=stop_on_copy

Клуб выпускников МГУ (Московский Государственный Университет) . Now that Vancouver has won the chance to host the 2010 Winter Olympics these are some questions people the world over are asking!! Believe it or not these questions about Canada were posted on an International Tourism Website (frightening, isn't it!) ... USA) . ... A: A-fri-ca is the big triangle shaped continent south of Europe. ... Q: I have a question about a famous animal in Canada, but I forget its . ...

Еще в разделе: (Показать все результаты (>69) - www.moscowuniversityclub.ru/ )

... Russian Participation in International Commerce before 1914 (Trans. from English - Y.A.Petrov.), . ... This article evaluates the strategies adopted by Russian traders, companies and banks to increase the country's participation level in international commerce before 1914. ... By 1914 Russian banks, railway and shipping companies, exporting either on a commission basis or on their own account, were significant players in the commodity export trade. ...

Еще в разделе: (Показать все результаты (>39) - hist.msu.ru/ )

• Russian Industrial Enterprises: Adaptation to Demand in the Background of

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/inf_syst_rus_2002.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

58. http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf

59. http://site2010.sai.msu.ru/static/doc/TTravouillon_TMT_site_testing_site2010.pdf

60. ExecModuleRequest