... MSU Chamber Orchestra . Concerts of . ... 1999/2000 season: . MOSCOW . ... German Music of XVII c. Johann ROSENMULLER (1620 - 1684) . ... Leontyevsky pereulok, 6 (metro station "Arbatskaya" or "Pushkinskaya") . ... MSU Chamber orchestra . ... Ulitsa Fadeeva, 4 (metro station "Mayakovskaya") . ... Big Hall of Moscow State University (the building at Vorobievy Gory) . ... MSU CHAMBER ORCHESTRA . ... The tickets are in the Moscow State Philarmony office . ... Big Hall of Moscow State University . ...

Еще в разделе: (Показать все результаты (>5) - music.genebee.msu.su/ )

• MSU Chamber Orchestra. Concerts. Season 2001/2002.
• MSU Chamber Orchestra. Concerts. Season 2000/2001.

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>12) - npidb.belozersky.msu.ru/ )

... NASA's newest Great Observatory, the Chandra X-Ray Observatory (CXO) -- formally known as the Advanced X-Ray Astrophysics Facility (AXAF) -- launched on July 23, 1999 and represents such an advance. ... Hughes Danbury Optical Systems (HDOS), now Raytheon Optical Systems Incorporated, figured and polished the x-ray optics; Optical Coating Laboratory Incorporated (OCLI) coated the polished optics with iridium; and Eastman Kodak Company (EKC) mounted and aligned the optics and provided the optical...

Еще в разделе: (Показать все результаты (>142) - xray.sai.msu.ru/ )

• Post main sequence stars (stage II)
• Main-sequence stars (stage I)

. Библиотека электронных публикаций . R. P. Gruber, L. F. Wagner, R. Block, S. Matthews. Subjective Time vs. Proper (Clock) Time (PDF file, 424 Kb) . Российский междисциплинарный семинар по темпорологии: ретроспектива. Доклад "Субъективное и астрономическое времена" (Ronald P.Gruber, L.F.Wagner, R.Block, S.Matthews). Апрель 2002 .

Еще в разделе: (Показать все результаты (>216) - chronos.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>5) - comphep.sinp.msu.ru/ )

... A new image object format suggested. ... DataPtr ­ pointer to image data row. ... Collections.Generic; System.Windows.Forms; Microsoft.JScript; Microsoft.JScript.Vsa; Microsoft.Vsa; } return result; // Reading script from file public static string ReadScriptFromFile( string fileName) { System.IO.StreamReader sr = new System.IO.StreamReader(fileName); string sScript = ; try { sScript = sr.ReadToEnd(); } catch (Exception ex) { //TODO } finally { sr.Close(); } } return sScript ...

Еще в разделе: (Показать все результаты (>40) - imaging.cmc.msu.ru/ )

... О Школе . ... Магистерская программа Высшей школы бизнеса МГУ получила международную аккредитацию ABEST21 . ... В 2015 году Высшая школа бизнеса МГУ подтвердила статус одной из ста лучших бизнес-школ мира и получила награду высшей категории как 'бизнес-школа, имеющая наивысшее международное влияние'. 21.10.2015 . ... Декан Высшей школы бизнеса МГУ О.С. Виханский получил награду от Международной ассоциации бизнес-образования ABEST21 за 10-летний вклад в работу ассоциации в качестве ее Вице-президента...

Еще в разделе: (Показать все результаты (>251) - www.mgubs.ru/ )

• Стратегии управления человеческими ресурсами глобальных компаний стран БРИКС.

... Method of recursive sequences in associated liquids theory . ... In case of chain association the comparison of RS-method with earlier developed matrix technique is performed. ... Moscow University Chemistry Bulletin . 2011, Vol. ... 3, P. 175 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>432) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 55, No. 2, P. 113 (2014)
• Entrance Examinations - Preliminary Round
• Спецкурсы кафедры "Химическая энзимология. Основы биоинформатики и

This page is devoted to information on Supernova 1999gi in NGC 3184 . ... Information on the original web pages for many of these images can be found on the Supernova links web page. ... NGC 3184 is a fairly close Mag 10.3 galaxy, only about half as distant as the Virgo cluster. ... Seiichi Yoshida has a 1999gi page . Odd Trondal's 1999gi page . ... CfA image . ... 14.5 . ... Jean Marie Llapasset image . ... vsnet-alert 3805 ] SN 1999gi in NGC 3184 . vsnet-chat 2438 ] Host galaxy of SN1999gi . ...

Еще в разделе: (Показать все результаты (>20) - www.rochesterastronomy.org/ )

LabVIEW. ... National Instument DAQ, LabVIEW LPT COM , GPIB . ... RS-232 GPIB . RS-232 / GPIB, LabVIEW. ... RS-232 IEEE-488 (GPIB). ... RS-232 , DTE (Data Terminal Equipment) -- ( ), -- DCE (Data Communications Equipment) -- ( ). DTE () -- , DCE () -- , RS-232 (, , ), . ... LabVIEW, National Instruments http://ni.com/support/gpib/versions.htm. ... VISA Read COM Receive GPIB ), , . VISA Write Send COM GPIB . ... VISA Read Receive , «read buffer» ( «data string» GPIB) Create\Indicator. ...

Еще в разделе: (Показать все результаты (>6) - www.test.physchem.msu.ru/ )

... Create New Order" -- . ... 1 2, : # OrderDetail (OrderMgr) # OrderMgr (Order) # OrderMgr (TransactionMgr) # TransactionMgr Order # TransactionMgr (OrderItem) # Order OrderItem 4. ... Boundaries: # OrderOptions # OrderOptions # OrderDetail # OrderDetail Boundaries: # OrderOptions OrderOptions # OrderDetail OrderDetail # OrderOptions OrderDetail Control: # OrderMgr # OrderMgr # TransactionMgr # TransactionMgr Control: # OrderMgr OrderMgr # TransactionMgr TransactionMgr # OrderMgr TransactionMgr 1. ...

Еще в разделе: (Показать все результаты (>135) - sp.cs.msu.ru/ )

• Lib-DVM. Interface description
• C-DVM language description. Part 1 (1 - 4)
• Fortran DVM language description. Part 1 (1-4)

... The main field of my investigations is stellar spectrophotometry. As a result of scientific activity of our group spectrophotometric catalog was created including energy distribution data on 900 stars in the range 3200-7600AA and 250 stars in the range 6000-10800AA (Voloshina et al., Spectrophotometry of Bright Stars, ed. I.N.Glushneva, 1982, Moscow, Nauka, in Russian). ...

Еще в разделе: (Показать все результаты (>3) - uranus.sai.msu.ru/ )

... Class . ... Nested classes inherited from class javax.swing.JApplet . ... private int . ... private java.lang.String[] . ... private static int . ... Fields inherited from class javax.swing.JApplet . ... Fields inherited from class java.applet.Applet . Fields inherited from class java.awt.Panel . Fields inherited from class java.awt.Container . Fields inherited from class java.awt.Component . ... Field Detail private static final int VERTICAL . ... private java.lang.String[] classes . ...

Еще в разделе: (Показать все результаты (>156) - angel.cs.msu.su/ )

• DataTable
• : Class RandomAccessFile
• LoginDialog

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Coordinator in Import Licensing of Special Technical Equipment (STE) . ... Acts as the consultant to business units in import and licensing area of Russian STE market. ... Acts as a specialist providing implementing of STE import, distribution and licensing processes and policies. ... Experience in coordination of IT legislation and IT Security area, STE import and licensing would be a significant advantage . ...

Еще в разделе: (Показать все результаты (>17) - www.physcareer.ru/ )

• Radio Frequency Licensing Coordinator (Graduate) / Вакансии / Physcareer.ru

... Поиск по МГУ | Лента новостей | ... О проекте . ... Please, enter the code that you see below in the input field. This is for blocking bots that try to post this form automatically. If the code is hard to read, then just try to guess it right. If you enter the wrong code, a new image is created and you get another chance to enter it right. ... 2003 2011 MsuNews.Ru Новости МГУ . 2003 2011 Разработка и дизайн MMForce.Net . ... Экспорт новостей (RSS) ...

Еще в разделе: (Показать все результаты (>10) - www.msunews.ru/ )

... 2 ZERO-ORDERED SEQUENCES OF SPARSE VECTORS Let X = {xk } be a sequence of sparse vectors from Kn, I = {ik } be a sequence of multiindices. ... L ..... uL x1 ..... x1 ..... xn NNp-1 u1 u p-1 xn NNp-1 u1 NN p up-1 ..... up Let's consider a following sequential chain SPN of linked -neurons: u1 = spn1(x), up = spnp(x, up-1), 7 where p = 2, . ... We learn -neurons spn1, . ... Let's consider a following multy-layered network SPNN of -neurons: u1 = spn1(x), up = spnp(x, up-1), where p = 2, . ... SPNp-1(x))...

Еще в разделе: (Показать все результаты (>28) - acat02.sinp.msu.ru/ )

... Форумы > Разное > Тема . ... Форумы Список тем Новая тема . ... Нужна помощь по Ассемблеру . ... mov dword [hConsole],eax . ... movzx ax,byte [var1] . mov esi,buf1+8 . ... movzx ax,byte [var2] . ... movzx ax,byte [var3] . ... invoke WriteConsoleA,dword [hConsole],buf1,30,buf1,0 . ... mov esi,buf+08h . ... buf1 db 'data A= ',' ',' ',' ',' ',' C= ',' ',' ',' ',' ',' D= ',' ',' ',' ',' ' . ... mov byte [esi+3],ah . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>37) - www.mmonline.ru/ )

• Эволюция Программиста

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. August 18, 1999 . Sun Block . ... Explanation: During a total solar eclipse, Earth's moon blocks the sun - almost exactly. While the sun is about 400 times wider than the moon, it is also about 400 times farther away and each appears to be half a degree or so in diameter. ... Tomorrow's picture: Light From The Dark Sun . ... About APOD > . ...

Еще в разделе: (Показать все результаты (>11) - www.arcetri.astro.it/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/inf_syst_rus_2002.pdf