... Electromagnetic Generation of High Harmonics of Ultrasound in Magnets . ... The propagation of ultrasound in magnetoelastic materials is accompanied by generation of high harmonics due to elastic nonlinearity and effective anharmonicity of coupled acoustic and spin waves. ... The generation of high harmonics of surface acoustic waves is caused by the appearance of elastic deformations synchronized in space and time in magnet. ...

Еще в разделе: (Показать все результаты (>165) - acs366.phys.msu.su/ )

• Schedule : Nonlinear Acoustics of the Atmosphere, the Ocean, and the Earth

... Fiber optic hidrophones . ... A fiber optic air backed mandrel hydrophone to detect high energy hadronic showers in the water". ( text ) . ... The realization of an optic fiber air backed mandrel hydrophone for frequencies up to 20 kHz". ( text ) . M. Anghinolfi, A. Bersani, A. Calvi, A. Cotrufo, M. Ivaldi, O. Ershova, F. Parodi, D. Piombo, A. Plotnikov and L. Repetto "Measurement of the frequency responsivity of a fiber optic air backed mandrel hydrophone up to 10 kHz in air". ( text ) . ...

Еще в разделе: (Показать все результаты (>10) - antares.sinp.msu.ru/ )

... Length = 10687 Score = 399 bits (1026), Expect = e-113 Identities = 202/337 (59%), Positives = 246/337 (72%), Gaps = 3/337 (0%) Frame = -3 Query : 3 YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPA---KPVNCMGLTFKNPLG 59 Y +RKALF LD E+AH+ T + L+ + +PF L++ P MGL FKNP+G Sbjct : 5999 YALIRKALFSLDAEQAHDLTIKTLKTLGRSPFNPLLKTLFACPTGSPKTIMGLHFKNPIG 5820 Query : 60 LAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLG 119 LAAG DK+GE I+ AMGFG IE+GTVTP Q GN KPR FRL +AEG+INR GFNN G ...

Еще в разделе: (Показать все результаты (>3833) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/all_blastn.txt
• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/cds_result.txt
• http://kodomo.cmm.msu.ru/~youthofchemist/projects/Term_3/Seqnuc/rsua_g.out

... Форумы > Разное > Тема . ... Состоялся финал международной студенческой конференции 'IT Security for the Next Generation'. Состоялся финал международной студенческой конференции 'IT Security for the Next Generation '. 13-15 апреля в Мюнхене состоялся финал международной студенческой конференции 'IT Security for the Next Generation ', который объединил победителей всех 3-х региональных отборочных туров (Европейского, Азиатско-Тихоокеанического региона, Ближнего ...

Еще в разделе: (Показать все результаты (>39) - www.mmonline.ru/ )

• MMOnline | Форумы | Разное
• MMOnline | Новости

O.A. Aktsipetrov, E.A. Gan'shina, V.S. Guschin, T.V. Misuryaev, T.V. Murzina. Magneto-induced second harmonic generation and magneto-optical Kerr effect in Co-Cu granular films. ... A.A. Fedyanin, T.V. Misuryaev, T.V. Murzina, and O.A. Aktsipetrov. ... O.A. Aktsipetrov, A.V. Melnikov, T.V. Murzina, A.A. Nikulin, A.N. Rubtsov DC-electric-field-induced optical second harmonic generation at the smooth metal-electrolyte interface // Surf. ...

Еще в разделе: (Показать все результаты (>35) - shg.phys.msu.ru/ )

• Milestones of the lab highway
• CURRICULUM VITAE
• Nick's Homepage

... To obtain a unique ID, a key must be used. ... Often, the ftok() function is used to generate key values for both the client and the server. LIBRARY FUNCTION: ftok(); PROTOTYPE: key_t ftok ( char *pathname, char proj ); RETURNS: new IPC key value if successful -1 if unsuccessful, errno set to return of stat() call . ... This doesn't guarantee uniqueness, but an application can check for collisions and retry the key generation. key_t mykey; mykey = ftok("/tmp/myapp", 'a'); . ...

Еще в разделе: (Показать все результаты (>254) - itpm.msu.su/ )

• mod_expires - Apache HTTP Server
• mod_ext_filter - Apache HTTP Server
• Getting Acquainted with NIS

... Monitoring of population of rare orchid Epipogium aphyllum (F.W. Schmidt) Sw. on the isl. ... We counted generative shoots and flowers on them; we also checked the presence of pollinia in all flowers. We fixed four damaged by animals inflorescences (one flower, two flowers and two inflorescences with three flowers) with 70% ethanol to estimate the potential seed production. ... In the groups of generative shoots only one rhizome gave rise to the two generative shoots. ...

Еще в разделе: (Показать все результаты (>6051) - herba.msu.ru/ )

• Population of Epipogium aphyllum on the Kem’-Ludskij archipelago (White Sea)
• img_0816.jpg
• img_8960.jpg

In general, homing endonucleases are meganucleases (i.e. they recognise and cut DNA sequences longer than 12 bp) encoded in various intervening sequences. ... Here we investigate the diversity of yeast intein-encoded LAGLIDADG endonucleases, and annotate their particular residues in terms of importance for DNA recognition, binding and cleavage. PFAM family PF05204 contains sequences of most of the yeast intein-encoded LAGLIDADG endonucleases. ...

Еще в разделе: (Показать все результаты (>272) - monkey.belozersky.msu.ru/ )

• SDP home page

Provided mainly for use in templates, this macro generates the parts of the topic view that relate to meta-data (attachments, forms etc.) ... all="on" to show hidden attachments. title="..." to show a title - only if attachments are displayed. template="..." to use a custom template for the rendering of attachments; default attachtables is used. "moved" - if a topic was moved or renamed, generates a message with details and a revert link . ... This topic: System > WebHome > Macros > VarMETA . ...

Еще в разделе: (Показать все результаты (>3687) - wiki.cmc.msu.ru/ )

• PerlDoc < System < Foswiki
• VarICONURL < System < Foswiki
• GenPDFAddOnPlugin < System < Foswiki

... MG1655 chromosome, complete genome Length=300 Score E Sequences producing significant alignments: (Bits) Value embl|AE009441|AE009441 Pyrobaculum aerophilum str. ... Length=2222430 Score = 98.4 bits (402), Expect = 5e-21 Identities = 150/234 (65%), Gaps = 1/234 (0%) Strand=Plus/Plus Query 68 CCCGCAGAAGAAGCACCGGCTAACTCCG-TGCCAGCAGCCGCGGTAATACGGAGGGTGCA 126 || ... Sbjct 97796 GTTCTCCCGCCGAAGTGCTTGAGATACTCGCAACCGTGAATCTCAAAAAGAGG 97848 > embl|AE006641|AE006641 Sulfolobus solfataricus P2, complete...

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/blast_default.out
• http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/megablast.out
• Align tool for DNA-protein complexes

... Shown that this calculation method may be applied for optimal completed of the laser cavities by the mirrors. ... 4]. , ( ) - sin j co s j Mj = pj (1 ) , - p sin co s j j j sin 2 1 1- j = arccos 2 2 nj , n j h j cos j , p j = n j cos j , j = 1- , - . ... rTE rTM . ... R = r r* ; TE TE TE : rTE = arctg Im rTE Re rTE rTM = arctg , Im rTM Re rTM - : : 0 rTM expi 2 Z= 0 - rTE exp - i 2 . ... M cw M ccw : M ccw =M cw cos( = si n ( ) ) - sin ( ) = S ( ) , cos( ) - . ... 11° L16. , (6). 10q 01(q+1), . ...

Еще в разделе: (Показать все результаты (>86) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Pavlovsky.pdf
• http://nuclphys.sinp.msu.ru/mirrors/2001_2c.pdf
• http://nuclphys.sinp.msu.ru/school/s08/s08_15.pdf

... Alexander Popov QFTHE P' 2010 , Golitsyno, September 14 2 Program package E vtGen The EvtGen package has been created for the simulation of the bhadrons decays at B-factories. ... Lowest order SM contributions to the decays. ... Alexander Popov QFTHE P' 2010 , Golitsyno, September 14 5 E vtGen model for rare radiative leptonic B-decays We prepare the new EvtGen model BSTOGLLMNT for rare radiative leptonic B-mesons decays. ... Alexander Popov QFTHE P' 2010 , Golitsyno, September 14 11 ...

Еще в разделе: (Показать все результаты (>71) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/qthep2014.pdf
• June 26, 2013

Giant Second-Harmonic Generation Enhancement in the Presence of Tamm Plasmon-Polariton B.I. A finog enov , V.O. Bessonov, and A.A. Fedyanin Lom onosov M oscow St at e Uni versit y, 1 Leni nski e gory, 119991, M oscow, Russi a afi nogenov@nanolab.phys.m su.ru Abstra ct: Giant enhancement of the second harmonic generation in metal/photonic cr ystal (PC) system obser ved in the vicinity of Tamm plasmon-polariton resonance due to str ong electromagnetic field localization at the metal and PC inter face. ...

Еще в разделе: (Показать все результаты (>49) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/thg_in_fishnet.pdf
• Static and ultrafast nonlinear optics of metamaterials | Laboratory of
• Alexander S. Shorokhov | Laboratory of Nanophotonics & Metamaterials

... Astronomy search engine . ... PhysicsWeb Home Page . ... Sternberg Astronomical Institute . ... Astro Space Center Home Page . ... Landau Institute for Theoretical Physics . ... Astronomy and Space Physics Dept of Kiev University . ... NATIONAL RADIO ASTRONOMY OBSERVATORY Home Page . University of Hawaii - Institute for Astronomy . ... Space Telescope Science Institute Home Page . ... Sky & Telescope: The Essential Magazine of Astronomy . ... Springer LINK - Physics Online Library . ... Home . ...

Еще в разделе: (Показать все результаты (>93) - astro.uni-altai.ru/ )

... Vol. ... Влияние рыночных отношений на организацию университетских исследований в канадских университетах: по данным опросов преподавателей в 1974-1983 и 1989-1998 гг. Ключевые слова: Высшая школа в условиях рыночной экономики. ... 2002. ... Исследовательская работа университетов США в целях национальной обороны. Ключевые слова: Наука в университетах. ... Ключевые слова: Связь университетов с промышленностью. ... Ключевые слова: Роль университетов в жизни общества. ЗАРУБЕЖНЫЕ УНИВЕРСИТЕТЫ. ...

Еще в разделе: (Показать все результаты (>40) - srcc.msu.ru/ )

• H.Zhang, D.Moss, N.Kleeorin, K.Kuzanyan, I.Rogachevskii, D.Sokoloff, Y.Gao,
• Laboratory of Informatics

Heat transfer intensification on surfaces with 'eddy generating' relief by subsonic incident flow velocity . ... Scheme of unit for determination of heat transfer and pressure drop coefficients (strain-gauge method) on plates with smooth relief and plates with 'eddy generating' relief . Unit for determination of heat transfer and pressure drop coefficients (strain-gauge method) on plates with smooth relief and plates with 'eddy generating' relief . ...

Еще в разделе: (Показать все результаты (>4) - termogaz.imec.msu.ru/ )

• supersonic dimples_e
• Numeric_e
• scientific results_e

International Laser Center of MSU . ... Education . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... In our work we have obtained analytical expressions, which describe the distributions of intensity and polarization in the cross-section of a second-harmonic (SH) light beam. It is found that the polarization state drastically changes along the cross-section of the signal light beam. ...

Еще в разделе: (Показать все результаты (>79) - ilc.phys.msu.ru/ )

• Публикация
• Grant detail
• "Lasers and nonlinear optics" practical course laboratory

KEYWORDS: language evolution, mathematical modelling, branching processes . ... 2 Basic assumptions. ... Dying out, giving birth, and preserving of sign's meanings. ... Modelling of language evolution should be based on some assumptions concerning its micro-level, i.e. level of its micro-units' development. ... That is why it has become the starting point in the building of the mathematical model for the development in time and synchronic correlation of the whole system of a sign's features. ...

Еще в разделе: (Показать все результаты (>29) - old.philol.msu.ru/ )

... High Brightness RTM . ... Techniques to generate short, small emittance electron bunches of several nC at energies of several MeV are being developed to drive free electron lasers, for accelerator research, to provide short laser Thomson scattering X-ray pulses, and to generate intense coherent millimeter radiation (e.g., synchrotron, transition, etc.) ... Generating several tens of MeV beams now requires large, expensive, energy inefficient accelerators available only at large laboratories. ...

60. APPLICATIONS: Optics and Quantum Electronics | Moscow University Supercomputing