... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>10) - uranus.sai.msu.ru/ )

General English» 2 « » . ... gerund and infinitive), cleft sentences. ... Give definitions to the following words and expressions to scrutinise innocuous a flipside gut feeling to strut one's stuff to be blighted by smth with bad grace to be in two minds a brainwave to speak one's mind 2. Make sentences with the following words and expressions -to be beyond one's grasp -to hold good -resilience -to have a good mind to do smth -to get a word in edgeways 3. ... Music and mood. ...

Еще в разделе: (Показать все результаты (>83) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/publications/komarova/komarova-the-earth-and-its-people.pdf

... Bus Tour around Moscow 35 per person Date: 17.06.2007 Time: 10:00 Duration: 5 hours The price includes: transportation, English speaking guide This excursion is to get you acquainted with the city of Moscow and its most important and beautiful sights. ... Peterhof means "Peter 's Court". ... Located on the steep slope in front of the palace the Grand Cascade of fountains embellished with bronze sculptures and bas-reliefs dedicated to Russia's victories in the Northern war. ...

Еще в разделе: (Показать все результаты (>105) - www.enzyme.chem.msu.ru/ )

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>46) - angel.cs.msu.su/ )

... My presentation mainly based on the experience I gained working as a co-ordinator of the Caucasus NGOs Forum in 1999 - 2000. ... The Forum is an example of an NGO network for conflict transformation. ... This is exacerbated by the fact that the Forum is a cross-conflict, cross-border, cross-cultural initiative, whereas most of the funders who support NGO work develop separate programmes for different states and even regions in the former Soviet Union. ... His work is based on the tenet "do no harm"....

Еще в разделе: (Показать все результаты (>102) - www.prof.msu.ru/ )

• FOREIGN LANGUAGES AND CULTURE EDUCATION THROUGH THE DIALOGUE OF CULTURES
• Commemoration of the centenary of Senator Fulbright's birth
• I GAINED WORKING AS A COORDINATOR OF THE CAUCASUS NGOS FORUM

... Twenty five years ago the first Russian papers dedicated to Surface Nonlinear Optics were published. This 25th anniversary allows us to look back on the early 1980s, the time of appearance of Surface Nonlinear Optics as a branch of Optics. Pioneering works by Prof. Y.R. Shen in the early 1980s, which were based on the 1960s fundamental ideas of Prof. N. Bloembergen, stimulated an explosion of such studies at Moscow State University and around the world. ... March 2008 ...

Еще в разделе: (Показать все результаты (>27) - shg.phys.msu.ru/ )

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>2) - mouse.genebee.msu.ru/ )

... MBA . EXECUTIVE MBA . ... Международные связи . ... Международная конференция в Риге 'Define Europe - Different Sculptors, One shape' . ... В конференции примут участие представители различных международных организаций: . ... Янис Биркс (Janis Birks) - Мэр г. Рига и др. ... Конференция будет проходить в Риге, Латвия с 8 по 11 Октября 2009 года. ... Executive MBA . ... Членство в международных образовательных ассоциациях и альянсах . ...

Еще в разделе: (Показать все результаты (>92) - www.mgubs.ru/ )

... The pivotal role of the beta 7 strand in the intersubunit contacts of different human small heat shock proteins. ... It is concluded that the beta 7 strand participates in the intersubunit interaction of four human small heat shock proteins (alpha B-crystallin, HspB1, HspB6, HspB8) having different structure of beta2 strand of alpha-crystallin domain and different length and composition of variable N- and C-terminal tails. ...

Еще в разделе: (Показать все результаты (>74) - biochem.bio.msu.ru/ )

• [Different domain organization of two main conformational states of
• Different neuronal Na(+)/K(+)-ATPase isoforms are involved in diverse signaling
• Chaperone-like activity of monomeric human 14-3-3zeta on different protein

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>37) - monkey.belozersky.msu.ru/ )

• SDP home page
• About this project
• Inquiry information || Schemes of phylogenetic trees

Anisotropy of Cosmic Rays. Origins, experiments, data analysis problems & methods. ... ANTARES problems and methods. ... 2D» experiments Name Tibet Air Shower Array Position 90.522o E, 30.102o N; 4300 m above sea level 30.11 N, 4300m a.s.l. Gran Sasso, 2000m Caucasus, 1700m (40deg N, 113 deg W), atmospheric depth of 860 gm/cm2 Energy 4,6.2,12,50, 300 TeV Gamma /CR mix Time 1997-1999 TibetII, 1999-2001 TibetIII (bigger HD array). 4 years 1 year Statistics 7x109 in ~1000 days Rate Ang. ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%203.pdf
• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf

... CMS BBQ 2013, Cessy, 10.7.2013 (10 photos) . 16th CMS RDMS Conference, Nor-Amberd, Armenia + Yerevan, Echmiadzin, Garni, Geghard, Amberd, 3-6.09.2013 (212 photos) . ... 14th CMS RDMS Conference, Varna, Bulgaria + Balchik, Albena, Sofia, 6-11.09.2010 (64 photos) . ... First Heavy-Ion Collisions in the CMS detector, CERN, Switzerland-France, 2.11-8.12.2010 (42 photos) . ... CMS visit and CMS Xmas Party, Point 5, CERN, France 13.12.2007 (29 photos) . ... Sergey Petrushanko sergeant@mail.cern.ch . ...

Еще в разделе: (Показать все результаты (>46) - lav01.sinp.msu.ru/ )

Shock waves in real gases with different specific heat ratios ahead of and behind shock fronts" . ... A physicomathematical model of shock waves in real gases with different specific heat ratios ahead of and behind shock fronts is considered in the approximation of an infinitely thin discontinuity. Several jump relations for gas- and thermodynamic parameters are obtained; when the specific heat ratios are constant, these relations become the well-known classical relations of gas dynamics. ...

Еще в разделе: (Показать все результаты (>135) - num-meth.srcc.msu.ru/ )

• "Nonlinear least-squares full waveform inversion: SVD analysis"
• "Modeling of flow separation at the inlet of a suction channel in regions with
• A probabilistic relation between the error estimates of physical quantities

.

Еще в разделе: (Показать все результаты (>336) - chronos.msu.ru/ )

• CHAPTER 4. EARTH SCIENCES
• Ontology of the Universe

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>108) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Notes on searching by similarity

... quantum optics - different types of the light interference, . ... Another branch of my activity covers the problem of biphoton interference (1997-). ... Also we developed the effective interferometric protocols to generate some specific quantum states of light (the Bell states) in the most common case: broad spectrum of the pump (in particular for the femtosecond laser), any type of phase-matching (either type-I or type-II), and arbitrary length of nonlinear crystals. ... QUANTUM TELEPORTER . ...

Еще в разделе: (Показать все результаты (>71) - qi.phys.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: I want to make russian friends!! [ re: abcabcabc ] . ... Re: I want to make russian friends!! ... abcabcabc . ... Re: I want to make russian friends!! [ re: lehainamt ] . ...

Еще в разделе: (Показать все результаты (>6861) - www.fds-net.ru/ )

• Walking around GZ - Public forum of MSU united student networks
• dancing around the world - Public forum of MSU united student networks
• Love Actually - Christmas is All Around - Public forum of MSU united student

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: I want to make russian friends!! [ re: abcabcabc ] . ... Re: I want to make russian friends!! ... abcabcabc . ... Re: I want to make russian friends!! [ re: lehainamt ] . ...

Еще в разделе: (Показать все результаты (>4154) - www.snto-msu.net/ )

• Walking around GZ - Public forum of MSU united student networks
• Love Actually - Christmas is All Around - Public forum of MSU united student
• Billy Mack - Christmas is All Around - Public forum of MSU united student

... Among them there is forward modeling for uniform anisotropic halfspace to calculate ARS diagrams for different arrays (AM (U), AMN (E), dipole equatorial (D), three-pole (T), Y and Arrow-type (AT) array, etc.), when source of current is on the earth surface or at a depth. All linear arrays (AM, AMN, dipole axial) give anisotropy ellipses with axis ratio equal to anisotropy coefficient, while non-linear arrays (D and others) have this ratio equal to anisotropy coefficient in the 5-th power. ...

Еще в разделе: (Показать все результаты (>62) - geophys.geol.msu.ru/ )

• Page 2
• IPI2win - 1D interpretation of VES profile.
• IPI_v76 - VES & VES-IP curves interpretation .

... Photos . Rainbow in Cambridge . ... Different phases of the lunar eclipse . ... Копосов Сергей , 2003-2007 . Koposov Sergey , 2007 ...

Еще в разделе: (Показать все результаты (>187) - lnfm1.sai.msu.ru/ )

• Photos from my trip to US (september 2005)
• Proposing a METI Institute
• Data bases of Natural Satellites. Documentation. Structure