The International Society for the Study of Time Fifteenth Triennial Conference Time and Trace June 30 - July 6, 2013 Orthodox Academy of Crete http://www.oac.gr/htm/main_en.html Call for Papers Proposals (300 words) due by June 30th, 2012 The International Society for the Study of Time (ISST) seeks proposals for presentations at its 2013 conference on the island of Crete, on the theme of Time and Trace. ... Works of literature were also called "brush traces" (hisseki) in Japanese. ...

Еще в разделе: (Показать все результаты (>34) - chronos.msu.ru/ )

• С Новым годом

RFBR/DFG грант 96-01-00028/Ei 280/2-1: Indextheorie und numerische Invarianten fur Mannigfaltigkeiten. Сотрудничество с немецкими исследовательскими группами J.Eichhorn (Greifswald), Th.Friedrich (Berlin), W.Luck (Munster). http://www.math-inf.uni-greifswald.de/analysis/eichhorn/ International Conference "Dirac operators, index theorems and numerical invariants of manifolds" (Usedom Island, Germany, March 7-13, 1999) 30 min. talk

Еще в разделе: (Показать все результаты (>7) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/OrgConferences/ger68.txt

FT CDS join(224735..224850,226744..226816) FT /codon_start=1 FT /gene="gs19" FT /product="unknown" FT /note="GENSCAN prediction; no supporting EST/Peptide FT evidence known at this time; supported by a CpG island" FT /db_xref="HGNC:14163" FT /db_xref="UniProtKB/TrEMBL:Q96S31" FT /protein_id="AAK61219.1" FT /translation="MAWGGVGACAFPPPPARLVGSDARGRGQRRGRVRGRGGRLLASIL FT LTSNGCLLLVTTQSLMD"

Еще в разделе: (Показать все результаты (>114) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~vanilin/3_1/PCOLCE.txt

... структура порожденного им редуцированного процесса, распределение момента рождения ближайшего общего предка всех частиц, существующих в популяции в далекий момент ближайшим общим предком. n , а также тип частицы , являющейся March 19 A. V. Vatutin N ( Steklov Mathematical Institute) Macroscopic and microscopic structures of the decomposable critical branching process A decomp osable strongly critical Galton-Watson branching pro cess with typ es of ... Particles of island N do not...

Еще в разделе: (Показать все результаты (>5) - new.math.msu.su/ )

... Parent Directory / . Directory . Japan, Tsunami. Coast Guard ship rides over the tsunami waves.wmv . 2014-Sep-17 18:54:26 . ... video/x-ms-wmv . ... Japan Nov 2013.wmv . ... Physics of tsunamis 02_rip.pdf . ... Rissagues y Meteo-tsunamis.wmv . ... Volcano Tsunami.mov.wmv . ...

Еще в разделе: (Показать все результаты (>6) - ocean.phys.msu.ru/ )

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. September 4, 1998 . Nozomi: Earth and Moon . Credit: Nozomi MIC Team , ISAS . ... This stunning picture of the crescent Earth-Moon system was taken by Nozomi's onboard camera on July 18 from a point in space about 100,000 miles from the Earth and 320,000 miles from the Moon. ... About APOD > . ...

Еще в разделе: (Показать все результаты (>4) - www.arcetri.astro.it/ )

Клуб выпускников МГУ (Московский Государственный Университет) . ... Жизненных функций, меняющихся в зависимости от чередования дня и ночи, много: сон и пробуждение, голод и жажда, кровяное давление, число сердечных сокращений, температура тела, активность иммунной системы. ... Но они, в свою очередь, действуют по приказу гена, который неслучайно получил название Clock ("часы"). ... Сегодня мы сумели понять, как работает Clock, - говорит Сассоне-Корси. ...

Еще в разделе: (Показать все результаты (>114) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "Чередование жизненных функций в
• Клуб выпускников МГУ: Конференция "Выпускники МГУ в Канаде"

... The term " safety culture " appeared in 1988, it has been stipulated by the Chernobyl catastrophe. ... Different definitions will be collated in the presentation; a necessity to develop a quantitative approach to safety culture will be demonstrated. ... What is the role of human errors in safety culture? Operators are often the weak link in any complex system, they are one of the biggest sources of errors in high-risk technologies. ... How to quantify human errors? ...

Еще в разделе: (Показать все результаты (>13) - www.prof.msu.ru/ )

This section will show some different pictures of Philippine paper money. ... During World War II, when the Japanese occupied the Philippine Islands, the resistance forces used their own form of money. ... A five peso note (front) . A five peso note (back) . A 20 peso note (front) . The back of a different 20 peso note (front) . Eventually I'll catalogue more of these and get the images loaded for you. Find more info on the Philippines at: . Philippines . ...

Еще в разделе: (Показать все результаты (>44) - xray.sai.msu.ru/ )

• Art Gallery

... Литература . ... Aniello C.A. Using Landsat-TM thermal data to map micro-urban heat islands in Dallas, Texas. ... Dousset B., Gourmelon F. Satellite multi-sensor data analysis of urban surface temperatures and landcover // ISPRS Journal of Photogrammetry Remote Sensing, 2003, ?58, p. 43-54; . Gluch R., Quattrochi D.A., Luvall J.C. A multi-scale approach to urban thermal analysis // Remote Sensing of Environment, 2006, ?104, p. 123-132; . ... The social impacts of heat waves: science report. ...

Еще в разделе: (Показать все результаты (>82) - www.geogr.msu.ru/ )

• CONTENTS ?4 - 2011
• CONTENTS ?6 - 2011
• CONTENTS ? 5 - 2013

... The burberry scarfs is to get a product of evolutionary level. ... Look at how many girls make the . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>9) - elana.sinp.msu.ru/ )

... Кумыса, бешбармака, самсы, баурсаков и прочих вкусных дел! ...and then we'd call it an island -- a tiny speck lurking outside the charted waters, like a breath of hope, no matter how delirious, like the delusion of faking one's own death for the promise to rise, transcended ... seeking restlessly to enter once more the prison of time, and attain a deliverance both in its memories and oblivion.....so we'd then call it an island just outside the ...

Еще в разделе: (Показать все результаты (>8) - comet.sai.msu.ru/ )

The XIIIth International Conference Cognitive Modeling in Linguistics (CML ­ 2011) Corfu, Greece September 22 ­ 29, 2011 _____________________ CALL FOR PAPERS _____________________ General Information Conferences of the series "Cognitive Modeling" have been successfully held since 1998. ... From 2003 to 2007 CML conferences took place in Bulgaria (Varna and Sofia). ... Conference Location The XIIIth International Conference "Cognitive Modeling in Linguistics" (CML­ 2011) will be held on Corfu, Greece. ...

Еще в разделе: (Показать все результаты (>42) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/mitrenina.pdf

... Treaty concerning the Cession of the Russian Possessions in North America by his Majesty the Emperor of all the Russias to the United States of America; Concluded March 30, 1867; Ratified by the United States May 28, 1867; Exchanged June 20, 1867; Proclaimed by the United States June 20, 1867. ... But the cession, with the right of immediate possession, is nevertheless to be deemed complete and absolute on the exchange of ratifications, without waiting for such formal delivery. ...

Еще в разделе: (Показать все результаты (>154) - www.pereplet.ru/ )

• Art Gallery

... Заключительные этапы эволюции магм Ключевского вулкана (Камчатка) по данным изучения расплавных включений в минералах высокоглиноземистых базальтов: данные по изучению магматических включений в минералах+Ключевского вулкана . ... Н.Л.Миронов " Эволюция высокоглиноземистых базальтов Ключевского вулкана (Камчатка) по данным изучения магматических включений в минералах " . ... Вулкан. ... Первичные расплавы известково-щелочных магнезиальных базальтов Ключевского вулкана (Камчатка) // Геохимия, 1998 . ...

Еще в разделе: (Показать все результаты (>26) - www.nature.web.ru/ )

• Заключительные этапы эволюции магм Ключевского вулкана (Камчатка) по данным
• Происхождение мантийных магм над зонами субдукции на примере офиолитового

... Research . ... Linguistic expeditions . ... Up to now the subjects to documentation were local dialects of Selkup, Ket, and Evenki. ... 1) creation and enlargement of multimedia computer archives of Selkup, Ket, and Evenki speech, which include sounding dictionaries and folklore texts and life-stories in audio, video, and graphic representation in local dialects of the surveyed villages; development of linguistic multimedia databases; . ... 8) research into the Selkup-Ket-Evenki language contacts; ....

57. http://ideas.msu.ru/docs/Cooperation_partners.pdf

58. http://atm563.phys.msu.ru/rus/gidromet_public_html/trudy/thmc3440112.pdf

---

Астронет | Научная сеть | ГАИШ МГУ | Поиск по МГУ | О проекте | Авторам

Комментарии, вопросы? Пишите: info@astronet.ru или сюда