... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Alt >> Hard .Linux >> Re: Новинки программного обеспечения . ... Re: Новинки программного обеспечения [ re: bmv ] . ... Celtx 2.0 . ... Celtx Studios . ... Celtx Client Changes . ...

Еще в разделе: (Показать все результаты (>5159) - www.snto-msu.net/ )

• VAR (Value at Risk) пакета акций - Public forum of MSU united student networks
• Проблемы с MSDN, что c VS2005 Feb CTP - Public forum of MSU united student
• Маркетолог - Координатор проекта "Product Value Information" - Public forum of

... Foswiki::Request::Cache - Class that implements a disk cache of Foswiki::Request objects. ... public package Foswiki::Request is a CGI . ... ObjectMethod action([$action]) $action . ... ObjectMethod queryParam( [-name $name, -value => $value | ObjectMethod bodyParam( [-name $name, -value => $value | ... Keys are uploaded file names, as sent by browser, and values are Foswiki::Request::Upload objects. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>22495) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) RegularExpression < System < Foswiki
• (backlinks in System Web) RegularExpression < System < Foswiki
• (backlinks in System Web) VarS < System < Foswiki

Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index . To move the sample on the Z-axis fast (it may need in the end of the work, for example) use SPM/ Move sample menu command. This command allow to move the sample up (to the probe) or down (from the probe) at specified value. Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>177) - www.spm.genebee.msu.ru/ )

• Changing Image Resolution
• Addition and Subtraction of Images
• Sample landing preferences

... About Journal | ... The Editorial team's publication decisions are made based on the data reliability and the scientific value of the work despite the race, gender, nationality, citizenship, social position, religious or political views of the Authors. ... The Reviewer performs the impartial expertise of Author's materials. ... The Reviewer must notify the editorial team on any interest conflict with the Author, with the request for excluding him from the reviewing of the given manuscript. ...

Еще в разделе: (Показать все результаты (>46) - www.socio.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ...

Еще в разделе: (Показать все результаты (>755) - istina.msu.ru/ )

• Science Technology and Human Values - журнал | ИСТИНА - Интеллектуальная
• Journal of Human Values - журнал | ИСТИНА - Интеллектуальная Система
• Boundary Value Problems - журнал | ИСТИНА - Интеллектуальная Система

This work has been presented at the Fifth Russian-Japanese Symposium on Ferroelectricity (Moscow, 1994) . ... Evaluations of anharmonicity constants b of free energy expansion made from dielectric measurements for SrTiO 3 and KTaO 3 [1] show the values obtained are dependent on the field strength of electrical bias in regular manner. ... In this conditions the rise of effective values of nonlinearity coefficients in relatively weak bias fields takes place necessarily. ... Moscow, 1990. ...

Еще в разделе: (Показать все результаты (>84) - scon155.phys.msu.su/ )

• Local field and optical second harmonics generation in polar Langmuir-Blodgett
• Polariton spectroscopy as a method of studying the effects of lattice

О лаборатории . ... Лаборатория теоретической биофизики . ... Here the guide to use RESP technique based on calculations from Firefly or GAMESS-US is presented. ... Note, that RESP algorythm will fit potential in the set of points which are selected according to $PDC group in the input-file. ... Нет комментариев " Using RESP with GAMESS-US and Firefly (PC-GAMESS) " . ... Using Firefly/GAMESS-US efficiently . ... Scannin? in Using Firefly/GAMESS-US efficiently? 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>39) - erg.biophys.msu.ru/ )

• Normal modes visualization for PyMol ERG Research Group: Лаборатория
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• Visualize partial charges in PyMol ERG Research Group: Лаборатория

THE PHOTOMETRIC RESEARCHS OF THE MERCURY'S SURFACE BY MEANS OF DIGITAL MODELS. ... The surface brightness of Mercury was measured Danjon (1933, 1949, 1953) and Harris (1961) in phase angle 3o-123o. The analysis of the various data of the integral photometric gives the results of determination of the main photometric constants for Mercury. ... THE PHOTOMETRIC RESEARCHS OF THE MERCURY'S SURFACE: S.G. Pugacheva The surface brightness of the Mercurian images was established on the geologic map Mercury. ...

Еще в разделе: (Показать все результаты (>88) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Greg/Publications/ms40/81_Ushkin_Michael.pdf
• http://selena.sai.msu.ru/Greg/Publications/ms38/ms090.pdf
• http://selena.sai.msu.ru/Shev/Publications/ms38/ms084.pdf

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>9) - bioinf.fbb.msu.ru/ )

• Input Formats

... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...

Еще в разделе: (Показать все результаты (>11) - swx.sinp.msu.ru/ )

• SWX - Главная

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>152) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• BLAST Frequently Asked Questions (FAQ)

VALUES, CANONS, PRICES Text as Means of Cultural Exchange VII Fulbright Summer School in the Humanities Moscow, June 22-30, 2004 Tuesday, June 22 Opening (MSU, 1 Humanities, 652) The Culture of Dialogue in the World Today (Discussion with participation of V. Pozner & S. Mailloux) Wednesday, June 23 Steven Mailloux Values and Valuations. U.S. Cultural Studies and Rhetorical Hermeneutics Elena Trubina Values Shared and Contested. ... Discussion) Monday, June 28 Steven Mailloux Values and Valuations. ...

Еще в разделе: (Показать все результаты (>321) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: Text conversions
• Совет молодых ученых филологического факультета МГУ им. М.В. Ломоносова

Вы посетили: activ_engl.html . ... История кафедры . ... Editor of the special issue of the journal Linear Algebra and its Applications devoted to Idempotent and Tropical Mathematics, 2010 . Editor of the journal Fundamental and Applied Mathematics . ... Linear Algebra and its Applications . Linear and Multilinear Algebra . ... Electronic Journal of Linear Algebra . ... staff/guterman/activ_engl.html.txt Последние изменения: 13.02.2013 11:26 (внешнее изменение) | ...

Еще в разделе: (Показать все результаты (>10) - halgebra.math.msu.su/ )

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>7) - textbook.sinp.msu.ru/ )

... Faculty . ... cmcproject@cs.msu.ru . ... head of the portal support working group . ... The portal was established in accordance with orders of the Dean of CMC Faculty Evgenyi Ivanovich Moiseev ? ... CMC MSU students at GSIS Summer School, Tohoku University, Japan . ... Second CMC MSU ? ... Delegation from Tohoku University (Japan) at CMC MSU . ... The Faculty Site is in the adjustment state. Any comments on the contents and functioning of the site should be addressed to cmcproject@cs.msu.ru . ...

Еще в разделе: (Показать все результаты (>100) - en.cs.msu.ru/ )

• About this site
• Laboratory of Programming Technologies
• Laboratory of Programming Technologies | CMC MSU

... Download NPG-explorer . ... Build nucleotide pangenome . ... Here we provide a table for 3 Brucella genomes: all: embl :CP002459 BRUMM chr1 c Brucella melitensis M28 chromosome 1 all: embl :CP002460 BRUMM chr2 c Brucella melitensis M28 chromosome 2 all: embl :CP003176 BRUAO chr1 c Brucella abortus A13334 chromosome 1 all: embl :CP003177 BRUAO chr2 c Brucella abortus A13334 chromosome 2 all: embl :CP002078 BRUPB chr1 c Brucella pinnipedialis B2/94 chromosome 1 all: ... Fix bugs....

Еще в разделе: (Показать все результаты (>6952) - mouse.belozersky.msu.ru/ )

• wLake algorithm description

... importance of terms such as 'geosols', 'paleosols' etc with interest. ... new zealand perspective is similar to that of Dr Crook of Australia - the . ... Some Quaternarists in New Zealand use 'buried soil' instead of buried . paleosol and the distinction is one of preference in the end (e.g Almond . ... I use the simple definition of a paleosol as a soil of a past landscape or . ... paleosols, and exhumed paleosols. ... surface' or 'non-buried' paleosols because these soils are clearly in the . ...

Еще в разделе: (Показать все результаты (>168) - www.fadr.msu.ru/ )

• INQUA/ISSS PALEOPEDOLOGY COMMISSION NEWSLETTER
• Working Groups
• the paleopedology working group had a conference last year in Mexico on "Global

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Servant >> Forum (Archive) . ... ФР]Специальный тег для картинок not safe for work . ... Re: [ФР]Специальный тег для картинок not safe for work [ re: mr_tron ] . ...

Еще в разделе: (Показать все результаты (>7383) - www.fds-net.ru/ )

• Новинки программного обеспечения - Public forum of MSU united student networks
• VAR (Value at Risk) пакета акций - Public forum of MSU united student networks
• как в питоне ненапряжно считать name=value из файла - Public forum of MSU

... x264 is an open source codec of standard MPEG4 AVC/H.264, developed by programmers from all over the world. ... Accumulated during previous frames' compressions statistic is actively used by codec to improve effectiveness of adaptive models. ... These parameters are used only before encoding start, so, our improvements are more significant for short sequences. ... 3 Results of codec x264 modification on "flower" sequence . ... 5 Results of codec x264 modification on "flower" sequence, low bitrates ....

Еще в разделе: (Показать все результаты (>199) - graphics.cs.msu.ru/ )

• x264 codec improvement | Лаборатория компьютерной графики и мультимедиа
• GML MatLab Camera Calibration Toolbox | Graphics and Media Lab
• Congratulations to winners of course work competition in CMC MSU! | Graphics

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...